KEGG   Sphingobacterium sp. 21: Sph21_5144Help
Entry
Sph21_5144        CDS       T01450                                 

Definition
histidinol-phosphate aminotransferase
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
shg  Sphingobacterium sp. 21
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:shg01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:shg00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:shg00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:shg00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:shg00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:shg00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6079983..6081047
Genome map
AA seq 354 aa AA seqDB search
MTINIQNLLRDNIRKLTPYSSARDEFKGEASILLDANENAFGSPLPVNYNRYPDPLQLNL
KEKVRQIKGVPTEHIFVGNGSDEAIDLLLRAFCRPGIDNIIIVPPTYGMYEVSANINDVL
IKRVPLTTEFQLDLNSIAETIDENSKIIFICSPNNPTGNSINRADIETLLNNFNGIVVVD
EAYINFAKQRSFIQELTEYNNLVVLQTLSKAWGLAGLRIGMAFAARDIIDVLNKIKPPYN
INEASQTLAIQALENVDEINTWIKTTVREREKLVKDLSTLPLIQYIYPSEANFILVKMTT
PREIYKYLVELGIIVRDRSSVILCEGCLRITIGTPEENQQLLHALRTYPLVNGQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaacattcaaaacctgttaagggacaatattagaaagcttacaccttattct
tccgctcgtgacgaatttaaaggagaagcttctatcttattagatgcaaatgaaaatgca
tttggttcacctttacctgtaaattacaaccgatatccggacccgctacaattaaactta
aaggaaaaagtccgccaaatcaaaggtgttcctacggaacatatttttgttggcaatgga
agcgacgaagcaattgaccttctattgagagccttttgtcgcccgggtatagacaatatt
attatcgttccgccaacctatggaatgtatgaagtatccgccaatatcaatgatgtttta
attaagcgcgtcccgctgacgacagaattccagttagaccttaatagcatagctgagacg
atcgatgaaaacagtaaaattattttcatctgttcgcccaacaatcctaccgggaattcg
atcaatagagcagatatagaaacgctgttgaataacttcaacggtatagtagtggtagat
gaagcctatataaacttcgccaaacaacgatcttttatacaagagttgacagaatataat
aacctggtagtgctgcaaacgctttctaaggcttggggattggcgggattgagaatagga
atggcttttgcggcccgcgatatcattgatgtgcttaacaaaataaagccgccatacaac
attaacgaagcgtctcaaacacttgcaatacaagctcttgaaaatgtagacgaaatcaac
acatggataaagactaccgtcagagaaagagagaaattagttaaagacctctcaacgctc
ccgcttatacaatacatctatccttcggaggcaaatttcatcttggtaaaaatgactacc
cctcgggaaatttacaaataccttgttgaactaggcattattgtacgcgaccgatcgtcg
gtcatattatgcgaaggatgcctacgtataactataggcactcccgaagaaaaccagcaa
ctcttacatgcacttcgcacgtatccgttggttaatggtcagtag

DBGET integrated database retrieval system