KEGG   Sphingobacterium sp. 21: Sph21_5196Help
Entry
Sph21_5196        CDS       T01450                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
shg  Sphingobacterium sp. 21
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sph21_5196
Enzymes [BR:shg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sph21_5196
Exosome [BR:shg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sph21_5196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6135535..6136503)
Genome map
AA seq 322 aa AA seqDB search
MIYRQRRLRKNPIVREMVAETHLSKDMFIYPYFIVPGNQIKHALPSLPGIHHFSIDKLIE
DVAIGLKLGVNKVMLFGVGEEKSADAHTAYDHHGLVPKAIRALREAFGEDLYIVTDVCVC
SYTTHGHCGILEHDYVQNDATIDVLTKMSLAHAEAGADMLAPSDMMDGRISAIRKALDEN
NQVNVAIMSHATKFASSYYGPFREAADCAPSKGDRKAYQMDFRNPNEALREAFLDEQEGA
DVLMIKPALAYLDVISRIKDETTLPLACYNVSGEFAMVKAAAQNGWIDEQKIVMETMYAF
ARAGARIITTYHIRDMVEQQWI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcgacaacgtagattacgtaaaaatccaattgtgagggagatggtggcagaa
actcatctgtcaaaggatatgtttatatatccttattttatcgttccaggaaatcaaata
aaacatgccttgccctccttaccgggtatacaccatttttctattgataaactgatagag
gacgtagcaattggattgaaactgggcgttaataaagtcatgctttttggggttggagaa
gagaagagtgcggatgcacacacggcttatgatcaccatgggctggttcctaaagccatc
agagcacttcgagaagcttttggtgaagatctatatattgtaacggatgtctgtgtatgt
tcttacacgacacacggacactgtgggattttagaacatgattatgttcagaatgatgcc
accatcgacgtgttaacaaaaatgtcacttgcgcatgcggaggccggggcggatatgtta
gctccttccgatatgatggacggcagaattagtgcaatcagaaaggcactggatgaaaat
aaccaggtaaacgtagcgattatgtcgcatgcaacaaaatttgcttcctcttattatggt
ccattcagggaagcagcagattgtgctccaagcaaaggagatcgaaaggcttatcagatg
gatttcagaaatcctaatgaggcattaagagaagcctttttagatgagcaagagggcgct
gatgtgctaatgattaaaccggctttagcttatctggatgttattagtaggatcaaggat
gaaaccactttgcctttggcatgctataatgtttcaggcgaatttgcaatggttaaagca
gctgcgcaaaacggctggatagacgagcaaaaaattgtaatggaaaccatgtatgctttt
gctcgtgcgggtgctcgtataattaccacttatcatattagagatatggtagagcagcag
tggatttaa

DBGET integrated database retrieval system