KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_02212Help
Entry
ShL2_02212        CDS       T03837                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:shh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ShL2_02212 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    ShL2_02212 (vraB)
   00640 Propanoate metabolism
    ShL2_02212 (vraB)
   00650 Butanoate metabolism
    ShL2_02212 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    ShL2_02212 (vraB)
   00072 Synthesis and degradation of ketone bodies
    ShL2_02212 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ShL2_02212 (vraB)
   00310 Lysine degradation
    ShL2_02212 (vraB)
   00380 Tryptophan metabolism
    ShL2_02212 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ShL2_02212 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ShL2_02212 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ShL2_02212 (vraB)
Enzymes [BR:shh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ShL2_02212 (vraB)
Exosome [BR:shh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ShL2_02212 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2291681..2292826)
Genome map
AA seq 381 aa AA seqDB search
MKEAVVIWAKRTPFGKYGGALRHLEPEALLLPLFQNLKQTFPEVMDQVDDVVLGNVVGNG
GNVARKSLLEAGLNHRIPGITLDRQCGSGLESIIYACRMVQCEAGKVFIAGGVESTSRAP
WKIKRPQSVYEMQLPQFFERASFAPEGQDPSMIEAAENVAQHYNISRNDQDLFAARSHRL
VATHFNNGDINREIVPLTIKGALFDRDESLKPNLTEARLHRLRPILPNGTVTVGNSCMKN
DGAGIALIMEKEMAVAMGIKWGMLYRDAVTTGVDPTLLGIGPVPAVSQLLKRQKLNIEDI
SAIELNEAFSSQVLASINELHLGLDKVNQWGGAIATGHPYSASGAALVARLLNLPNWQYG
IATMGIGGGMGNAVLFEKWRQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagttgtaatatgggctaaaagaacaccgtttggtaaatatggtggtgcg
ttaagacatttagaacctgaagcgctgttgttaccactttttcaaaatttgaagcaaaca
tttcctgaagtaatggatcaagtggatgatgttgtattaggtaatgttgtagggaatggt
ggtaatgttgcgagaaagtcgttactagaagccggtttaaatcatcgaattcctggcata
acattagaccgtcaatgtggctcgggtttagaaagtatcatttatgcgtgtcgaatggtg
caatgtgaggctgggaaggtgttcattgctggtggcgtagagagtacaagtcgtgcacca
tggaagattaagcgtcctcaatctgtctatgaaatgcaattaccacaattttttgagcgt
gcatcatttgcacctgaaggtcaagatccaagcatgatagaagcagctgagaatgtcgca
caacattataatatatctcgtaatgatcaagacttatttgcagcacgtagtcatcggtta
gtggcaacgcattttaataatggtgatattaaccgtgagattgttcctcttacaattaaa
ggagcgttgtttgatagggatgaaagtttaaagccaaatctgactgaggcgcgtttacat
agattacgtccaatattaccaaatggtacagttacagttggtaatagttgcatgaagaat
gatggtgccggaatagctttaataatggaaaaggaaatggctgtggcaatggggattaaa
tggggaatgttatatagagatgctgttacaacaggtgtggatccaaccttattagggata
ggtccagtacccgcagtttctcaattattgaaaaggcagaaattaaatattgaagatata
tcagccattgaactgaacgaagcatttagttctcaagtgctggcatctataaatgagttg
catttaggtttggacaaggtaaatcaatggggaggtgcgattgctactggacatccatat
agtgctagtggcgcggcattagttgctagattattaaacttacctaattggcaatatgga
attgctacgatgggtataggaggaggtatgggaaatgcggtactctttgaaaagtggcgc
caatga

DBGET integrated database retrieval system