KEGG   Slackia heliotrinireducens: Shel_00140Help
Entry
Shel_00140        CDS       T00981                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00900  Terpenoid backbone biosynthesis
shi01100  Metabolic pathways
shi01110  Biosynthesis of secondary metabolites
shi01130  Biosynthesis of antibiotics
Module
shi_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shel_00140
Enzymes [BR:shi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Shel_00140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACV21090
UniProt: C7N0L2
Position
21130..22116
Genome map
AA seq 328 aa AA seqDB search
MNHVRVFSPAKVNLHLDISERRPDGYHGAYSIMHALSMHDMLTMRREFAAPGSGLVVDVH
CATHGDIAELNIPAESNIAYKAVVRLAEALGRTGDDSVLIGIDKNIPHAAGLGGGSSNAA
AALLGACALWDIDLADTGVRAIVEQVASGLGADVPFFLHGGCVALTDKGDIYERDLVPSK
RNVVIVRPEEGVSTGAAYAAFDANPPLSSDEVKADARAAESADDLHLFNNLAPASEGLLP
VLTDIREWLSGHAGVAHDATTGAPQVLLCGSGSSTFAICDDFDAAYKLVGDARLNGWWAR
SCNFTSAGARVLPTAGQATNLGAVQKSW
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgtgcgcgtgttctcgccggccaaggtgaatctgcatcttgatatcagcgag
cgccggccggacggctaccatggggcttattccatcatgcatgcgctgtcgatgcacgac
atgctgaccatgcgccgtgagtttgcggcgccgggctcgggcttggttgtggatgtgcat
tgcgccacccatggcgatattgctgagctgaacattcccgcagaatcgaacatcgcttac
aaggccgtcgtccgtcttgccgaggctcttggacggactggggatgattccgttctgata
ggtatcgacaagaacattccccatgcggcggggctaggcggcggttcgtcaaacgccgct
gcagcgctgctgggtgcctgtgcgctatgggatatagacttggccgacactggtgttcgc
gcgatcgtggagcaggtggcatcaggattgggtgccgacgtgcctttcttcctgcacggc
gggtgcgtggcccttaccgataagggcgacatatacgagcgtgacctggtgcctagcaaa
cgcaacgtggtcattgtgcggcctgaggagggtgtttccaccggcgctgcctatgcggca
ttcgacgcgaatccgcctctgtccagcgacgaggtcaaagcggacgcccgtgcggctgaa
tccgccgacgacctgcatcttttcaacaacctggctcccgcttccgaaggcctgctgccg
gttctgaccgatattcgcgagtggttgtcgggccatgcgggcgtagcgcatgatgcaacc
acaggtgcgccccaggtccttctgtgcggcagtggttcgtccaccttcgccatctgcgac
gacttcgatgcggcctacaagcttgtgggtgacgctcgattgaacggctggtgggcccgc
agctgcaatttcaccagcgcaggagcgcgcgtgctgcccacggcgggtcaggccaccaac
cttggtgccgtgcaaaagtcctggtag

DBGET integrated database retrieval system