KEGG   Slackia heliotrinireducens: Shel_00140Help
Entry
Shel_00140        CDS       T00981                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
shi  Slackia heliotrinireducens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:shi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21130..22116
Genome map
AA seq 328 aa AA seqDB search
MNHVRVFSPAKVNLHLDISERRPDGYHGAYSIMHALSMHDMLTMRREFAAPGSGLVVDVH
CATHGDIAELNIPAESNIAYKAVVRLAEALGRTGDDSVLIGIDKNIPHAAGLGGGSSNAA
AALLGACALWDIDLADTGVRAIVEQVASGLGADVPFFLHGGCVALTDKGDIYERDLVPSK
RNVVIVRPEEGVSTGAAYAAFDANPPLSSDEVKADARAAESADDLHLFNNLAPASEGLLP
VLTDIREWLSGHAGVAHDATTGAPQVLLCGSGSSTFAICDDFDAAYKLVGDARLNGWWAR
SCNFTSAGARVLPTAGQATNLGAVQKSW
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgtgcgcgtgttctcgccggccaaggtgaatctgcatcttgatatcagcgag
cgccggccggacggctaccatggggcttattccatcatgcatgcgctgtcgatgcacgac
atgctgaccatgcgccgtgagtttgcggcgccgggctcgggcttggttgtggatgtgcat
tgcgccacccatggcgatattgctgagctgaacattcccgcagaatcgaacatcgcttac
aaggccgtcgtccgtcttgccgaggctcttggacggactggggatgattccgttctgata
ggtatcgacaagaacattccccatgcggcggggctaggcggcggttcgtcaaacgccgct
gcagcgctgctgggtgcctgtgcgctatgggatatagacttggccgacactggtgttcgc
gcgatcgtggagcaggtggcatcaggattgggtgccgacgtgcctttcttcctgcacggc
gggtgcgtggcccttaccgataagggcgacatatacgagcgtgacctggtgcctagcaaa
cgcaacgtggtcattgtgcggcctgaggagggtgtttccaccggcgctgcctatgcggca
ttcgacgcgaatccgcctctgtccagcgacgaggtcaaagcggacgcccgtgcggctgaa
tccgccgacgacctgcatcttttcaacaacctggctcccgcttccgaaggcctgctgccg
gttctgaccgatattcgcgagtggttgtcgggccatgcgggcgtagcgcatgatgcaacc
acaggtgcgccccaggtccttctgtgcggcagtggttcgtccaccttcgccatctgcgac
gacttcgatgcggcctacaagcttgtgggtgacgctcgattgaacggctggtgggcccgc
agctgcaatttcaccagcgcaggagcgcgcgtgctgcccacggcgggtcaggccaccaac
cttggtgccgtgcaaaagtcctggtag

DBGET integrated database retrieval system