KEGG   Slackia heliotrinireducens: Shel_00220Help
Entry
Shel_00220        CDS       T00981                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
shi  Slackia heliotrinireducens
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:shi00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:shi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(29418..30899)
Genome map
AA seq 493 aa AA seqDB search
MLADAGVQAQATGEATVQGMTIDSRKAEPGCLFVCKGAAFKPQYLGGALDAGAAAYLCDA
AAEATLAQAYPQAPHIVTDDVRRAMALLAAVVFDRPDLKIDVVGITGTKGKSTTAYMMRS
ILIAAGQEPSILGSIDTDDGVEHFESHNTTPEAPDLWRHLANTVEAGRSRMVMEVSSHGL
KYDRTLGVRFAIGCFLNIGRDHISPVEHPTFEDYFESKLKLFAQSRTALVNLNSDMADQV
LEAAKASEQLVTFGVGRDDADWNAADLAVEPQGIAFTVCTPTGERERIVLGMAGLFNVEN
ALAAVVMSRMLGVTWDDIRAGLAHVRVPGRMEVVRSADGSVVALVDYAHNELSFKTFFSS
VKEEYPGRKVIAVFGAPGNKAQERRVTLPRVAAGFADHMIFTEEDPAYERVEDICAEMMA
STPAGASAEVICDREAACKRAFDMAFEAENGAVVALLAKGDETRQHRGDEFPEVKSDLAI
AREILGSTGEVDA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgttggccgatgccggcgtacaagcccaggccacgggcgaagccaccgtacagggcatg
accatcgattcccgcaaggccgagccgggttgtttgttcgtttgtaagggcgcggcgttc
aaaccccagtacctgggcggagcgcttgacgccggagctgcggcgtacctgtgcgatgca
gccgccgaagccaccttggcgcaggcctatccgcaggcgccgcacatcgtgaccgacgac
gtgcgcagggccatggcgcttctggccgccgtggtgttcgaccggcccgacctcaagatc
gacgtggtaggcatcacgggcaccaaaggcaagtcgaccacagcatatatgatgcgctcg
attcttatcgccgcaggtcaggagccttctattttgggctctatcgacactgacgacggt
gtggaacacttcgagagccacaacaccactcccgaggcaccggatttgtggcgccacctg
gccaacaccgtcgaagccggccgcagccgcatggtgatggaggtgtctagccacggcttg
aaatacgaccgcacgctgggcgttcgctttgccatcgggtgcttcctcaacatcgggcgc
gaccacatctcgccagtcgagcaccccaccttcgaggactacttcgagtccaagctcaag
ctgttcgcccaaagccgcacggccctggtcaacctgaattccgacatggccgaccaggtg
ctggaagccgcgaaggcctccgagcagctggtcactttcggcgtggggcgcgatgatgcc
gactggaacgcggcggacttggccgtggagccgcagggcatcgcgtttaccgtgtgcacg
cccacaggcgagcgcgagcgcatcgtgctgggcatggcgggtctgttcaatgtcgaaaac
gccctggctgcggtggtcatgagccgtatgctaggtgtgacctgggacgatatccgcgca
ggcttggcccatgtgcgcgtgcccggccgtatggaggtcgtgcgctccgccgacggcagc
gtggtggcgctggttgattatgcccacaacgagctgtcgttcaagaccttcttctcgtcg
gttaaggaagaataccctggccgcaaggtgattgcggtgttcggtgcgcctggcaacaag
gcccaggagcggcgtgtgacgttgccccgggtggcggccgggtttgccgaccatatgatc
tttaccgaggaagaccccgcctatgagcgggtagaagacatctgcgccgagatgatggcg
agcacgcccgcgggcgcttccgccgaggtgatctgcgaccgcgaggccgcgtgcaagcgc
gccttcgacatggcgtttgaggctgaaaacggcgccgtggtggcgcttctggccaagggc
gacgaaacccgccagcatcgcggtgacgagtttcccgaggtcaagagcgaccttgccatc
gcacgtgagattctaggcagcaccggggaggtggatgcgtaa

DBGET integrated database retrieval system