KEGG   Slackia heliotrinireducens: Shel_00500Help
Entry
Shel_00500        CDS       T00981                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
shi  Slackia heliotrinireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shel_00500
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shel_00500
Enzymes [BR:shi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Shel_00500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
66417..67829
Genome map
AA seq 470 aa AA seqDB search
MENQKNPYRIYLREDQIPTQYYNLRADMPEPPEPMRLPDGTVAQFEHLAPVFADELVRQE
LDNETRYVDIPEGIREMYKVYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSA
LAQAYYAHEQGLTTITTETGAGQWGTALSEAAAHYGLNCDVFMVRASYEQKPFRRSVMQT
FGAQVTPSPSQETEIGRKMYADEANRSGSLGTAISEAVERALHVPENKGRYQLGSVLNQV
VLHQSIIGLESLAAFDELGEYPDVVIGCAGGGSNLGGLIAPFMRDKLTGEKPDTRFIAVE
PASCPSLTRGRYAYDFADTGQTCPLVKMYTLGNGFIPSPDHAGGLRYHGMSPIISKLKHD
GYLDAVSVKQTDVFAAAEEFAKLETILPAPESAHAICVAMEEARKCAETGEEKVILFGLT
GTGYFDMTAYEAFNNGTMVDHVPTDEELERGFATIPAVPGIQDAGGAPVA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccagaagaacccctaccgcatctacctgcgcgaagaccagattcccacgcag
tattacaacctgcgcgccgacatgcccgagccgcccgagcccatgcgtctgcccgacggc
acagtggcgcagttcgagcacttggcacccgtgttcgccgacgagctggtccgccaagag
ctcgacaacgagacgcgctacgtggacatccccgagggaatccgcgagatgtacaaggtg
taccgccccagcccgctgtgccgtgcgtacaacttggaaaaggccctgggcacgccggcc
aagatctactacaagttcgagggaaacaacacgtcgggctcgcataagctgaactcggcg
ctggcccaggcctactacgcccatgagcaggggttgaccaccatcaccaccgagaccgga
gccggccaatggggcaccgcgctgtccgaggcagccgcgcactacgggctgaactgcgac
gtcttcatggtgcgcgcatcctacgagcagaagcccttccgccgttccgtcatgcagacc
ttcggcgcccaggtcacgccgtcgccttcacaggaaaccgaaatcggccgcaagatgtat
gccgacgaggcgaaccgttccggatcgctgggcaccgccatttccgaggccgtggagcgc
gcgctgcatgttcccgagaacaagggtcgctaccagctgggatccgtgctcaaccaggtg
gtgctgcaccagtccatcatcggtcttgaaagcctggctgcctttgatgagctgggcgaa
tatcccgacgtggtcatcggctgcgctggcggcggctccaacctgggcggcctgatcgcg
ccgttcatgcgtgacaagctgaccggcgaaaagcccgatacgcgtttcatcgccgtggag
cccgcgagctgcccgagcctgacccgtggccgctacgcctacgacttcgccgatacgggc
cagacctgcccgctggtcaagatgtacacgctgggtaacgggttcattcccagccccgat
catgccggcggcctgcgctaccacggcatgagccctatcatctccaagttgaagcatgac
gggtacctggacgccgtcagcgtgaaacagaccgacgtgttcgcggcggccgaagagttc
gccaagttggaaaccatcctgcccgcgcccgaaagcgctcatgccatttgcgtcgccatg
gaagaggcccgcaagtgcgccgaaaccggtgaggagaaggtcatcctgttcggcctgacc
ggcaccgggtacttcgacatgacggcctatgaggcgttcaacaacgggaccatggtcgac
cacgttcccaccgacgaggagctggagcgcggatttgccaccattcctgcggtgcccggc
atccaggacgcaggcggcgcacccgtggcatag

DBGET integrated database retrieval system