KEGG   Slackia heliotrinireducens: Shel_02210Help
Entry
Shel_02210        CDS       T00981                                 

Definition
(GenBank) dipeptidase, putative
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00300  Lysine biosynthesis
shi01100  Metabolic pathways
shi01120  Microbial metabolism in diverse environments
shi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Shel_02210
Enzymes [BR:shi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Shel_02210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACV21291
UniProt: C7N1J9
Position
complement(271191..272645)
Genome map
AA seq 484 aa AA seqDB search
MADEELLRAADEFIASNWEDIVSDIAKMIAVPSVVDFDAATPEHPSGPAAHEGLKAAVAL
AERLGFESVDDAGEIGFADLPGTSDTLLAMICHADVVAPGIGWTLDPWTMLRKDGFLLGR
GVIDDKGPLVIALYAMKFFQERDARLPYTLRMIFGTNEETGCMRDVAYYQEKYGSPAFLF
TPDNTFPVCYGEKGGYRGILRSPGFENGTIVDFTTGGSATNAVPGLAKLTLKAHADALPP
AEGIAFEAAGDGLVTLTATGVAGHAAMPEGTVSAIGMLVAYLLEHNLTTAAESTWLRGLD
AVIGHTDGSGVGIACSDEDFGPLTCVAGTIHRVDDRFNVTLDLRYPTTITPDEMGAAFAA
LAEEFGGSFSGKSVMEPFLMDKNSDIIRVFAEAYHDATGLDGDPFTSGGATYAREFPRAV
SFGVEDPHDSYPAWVGGMHAADEGVSEETLKRALRTYILTISRLMELDLDRFAGEHPSAA
EAAE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaggaacttttgcgggccgcagatgaattcatagcttcgaactgggaagac
atcgtttccgacatcgcgaagatgatcgcggtgccaagcgtcgtcgatttcgacgccgcc
acccccgaacatcccagcggacccgccgcccacgaggggctgaaggccgccgtggcgctg
gccgaacgcctgggcttcgaatccgtcgacgacgccggcgaaatcgggtttgcggacctg
cccggcacatccgacacgctgctcgccatgatctgccacgccgacgtggtggcaccaggc
atcggctggacgctggacccctggaccatgctccgcaaggacggtttcctgctgggccgc
ggcgtgatcgacgacaagggaccgctggtcatagccctgtacgccatgaaattcttccaa
gagcgcgacgcgcggctgccctacaccctgcgcatgatcttcggcaccaacgaggagacg
ggctgcatgcgcgatgtggcctactaccaggagaaatacggttcgcctgccttcctgttc
acgcccgacaacaccttccccgtctgctatggtgaaaagggcggctaccgcggaatcctt
cggtctcccggcttcgaaaacggcaccatcgtagacttcaccacgggcggatccgccacc
aatgccgtgcctggcctggcgaaactcaccttgaaggcccatgcggacgccctgcctcct
gcagaagggatcgccttcgaagccgccggcgacggtctggtcaccctgaccgccacaggt
gtggcgggacatgcggctatgcccgaaggcaccgtgagcgccatcggcatgctggttgcc
tacctgctcgaacacaacctgaccaccgccgccgaatcgacctggctgcgcgggctggac
gccgttattggccatacggacggctcgggcgtcggcatcgcctgctccgacgaggatttc
gggccgctgacctgcgtcgcaggtaccatccatcgcgtcgacgaccgcttcaacgtcacg
ctggaccttcgttaccccaccaccatcacccccgatgagatgggcgccgccttcgccgcg
ttggccgaagagttcggcggcagcttcagcgggaaatccgtgatggaacccttcctgatg
gacaagaactccgacatcatccgggtgttcgccgaggcctaccacgacgcgaccgggctg
gacggcgaccccttcacctcgggcggcgccacctatgcccgcgaattcccccgcgccgtc
agcttcggcgtcgaggatccgcacgacagctatcccgcatgggtgggcggcatgcacgcc
gctgacgagggcgtttccgaagaaaccctcaaacgggcgctgcgcacctacatactgaca
atttcgcgcttgatggagctggacctcgaccggttcgccggcgaacacccctccgccgcc
gaagccgccgaatag

DBGET integrated database retrieval system