KEGG   Slackia heliotrinireducens: Shel_02350Help
Entry
Shel_02350        CDS       T00981                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
shi  Slackia heliotrinireducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:shi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Shel_02350
DNA repair and recombination proteins [BR:shi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Shel_02350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
285001..285597
Genome map
AA seq 198 aa AA seqDB search
MESAPAIQRLLDELERMPGVGPKSAQRIAYWLLNADRETAMRLADAIIEVKDTVHFCSRC
FNYAEGDTCEICASKSRDERTLCVVSEPRDISAIERTSAYRGLYHVLGGALSPMEGIGPD
DLKITELMARLATEDIAEVVLATNPNVEGETTATYLARIIKPLGIQVSRLASGLPVGGDL
EFADEVTLGRAIEARRTL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtggaatcggcccccgccatccaacgtctgctcgacgagctggaacgcatgcccggcgtc
ggcccgaagagcgctcaacgtatcgcgtactggctgctcaatgccgaccgcgagacggcc
atgcgccttgctgacgccattatcgaggtgaaggacaccgttcatttctgctcgcggtgc
ttcaactacgccgaaggagacacctgcgagatctgcgcgtccaagagccgcgacgagcgc
acgttgtgtgtggtctccgagccgcgggacatctcggccatcgagcgcacctcggcgtat
cgaggcctgtaccacgtgctgggcggcgcgctgtcgcccatggagggcatcggccccgac
gacctgaagatcaccgagctgatggcgcgccttgccaccgaggatattgccgaggtggtg
ctggctacgaaccctaacgtggaaggggagaccacggccacatacctcgcgcggatcatc
aaaccgttgggcatccaggtgtcgcgtctggccagcggcctgcccgtcggcggcgatttg
gagttcgcggacgaagtcaccttgggtcgcgccatcgaggcccgacggacgctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system