KEGG   Slackia heliotrinireducens: Shel_02350Help
Entry
Shel_02350        CDS       T00981                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
shi  Slackia heliotrinireducens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:shi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
285001..285597
Genome map
AA seq 198 aa AA seqDB search
MESAPAIQRLLDELERMPGVGPKSAQRIAYWLLNADRETAMRLADAIIEVKDTVHFCSRC
FNYAEGDTCEICASKSRDERTLCVVSEPRDISAIERTSAYRGLYHVLGGALSPMEGIGPD
DLKITELMARLATEDIAEVVLATNPNVEGETTATYLARIIKPLGIQVSRLASGLPVGGDL
EFADEVTLGRAIEARRTL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtggaatcggcccccgccatccaacgtctgctcgacgagctggaacgcatgcccggcgtc
ggcccgaagagcgctcaacgtatcgcgtactggctgctcaatgccgaccgcgagacggcc
atgcgccttgctgacgccattatcgaggtgaaggacaccgttcatttctgctcgcggtgc
ttcaactacgccgaaggagacacctgcgagatctgcgcgtccaagagccgcgacgagcgc
acgttgtgtgtggtctccgagccgcgggacatctcggccatcgagcgcacctcggcgtat
cgaggcctgtaccacgtgctgggcggcgcgctgtcgcccatggagggcatcggccccgac
gacctgaagatcaccgagctgatggcgcgccttgccaccgaggatattgccgaggtggtg
ctggctacgaaccctaacgtggaaggggagaccacggccacatacctcgcgcggatcatc
aaaccgttgggcatccaggtgtcgcgtctggccagcggcctgcccgtcggcggcgatttg
gagttcgcggacgaagtcaccttgggtcgcgccatcgaggcccgacggacgctgtaa

DBGET integrated database retrieval system