KEGG   Slackia heliotrinireducens: Shel_06470Help
Entry
Shel_06470        CDS       T00981                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
shi  Slackia heliotrinireducens
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Shel_06470
  Lipid metabolism
   00561 Glycerolipid metabolism
    Shel_06470
   00600 Sphingolipid metabolism
    Shel_06470
Enzymes [BR:shi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Shel_06470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(753619..755388)
Genome map
AA seq 589 aa AA seqDB search
MRPIRCFVSYRLVGESNEKARRTLVKILDSESEAPSDVEPEDEPKTINAETVKMYTDAIR
AAEKQDAMPDAEVQDDEDEGSPKRNISINCTFDQEVFSVSVDVMSDVRIESCMVVWSHEF
SNDERILLNGWQSWTDTQELPIDGYMRGLKRVPAPLIRRFVLDGSGDYRFTEYTNKPGQL
HGWTYGYIRDDRTCTLIAGLDESRGFTHIRTDCKENLLFVLPEAPAREFKDGDTVEFGRF
AVIERTDAEDVDKATEAAFDRWFELNGIQARTCKPACGYTTWYRHYGRINETVLCRDFDA
VRSVFERVDASGFERVFQIDDGFCKIGDWLDVDRKCFPAGPAPMAQHISRKGFTPGIWLA
PFAVEKDARIGHEHPDWVLCDEKGNAVTIGSNWSGAYALDTRNPEVRAYVTEVIRTYTQD
WGFKLLKLDFLYAACMIPHDGMNRGELMADAMRLLRDAAGEDVLIDGCGVPLASAFGLVD
YCRISCDVGNDWDDLPSRRMLHRERVSTKHSVSNTVWRAHLNRRAFRNDSDVVYLRTDVQ
LNMEQRTMLLDRSAVFSGVLFTSDNMGAWDDNQIERWQNAIDLMRLANR
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgagacccatacgctgctttgtttcataccgccttgtcggcgagtccaacgaaaaagct
cggcgcaccttggtgaagattctcgattcagaatcggaagccccatcggatgtagaaccg
gaagatgaaccgaagaccataaacgccgaaacggtgaagatgtacaccgacgcgattcgt
gccgctgaaaaacaggacgcaatgcctgatgccgaagtgcaggacgacgaggacgaaggt
tcgccaaagcgaaacatcagcatcaactgcaccttcgaccaggaggtgttctccgtttcc
gtcgacgtcatgagcgacgtgcgcatcgaatcctgtatggtcgtatggtcccatgagttc
agtaacgacgaacgcattcttctgaacggatggcaatcttggaccgacacgcaggaattg
cctatcgatgggtacatgcgcggcctgaaacgcgtgcctgcaccgcttatccgtcgtttc
gtgctggatggctcgggcgactaccgctttaccgaatacacaaacaagcccggacagctt
cacggatggacgtacgggtatattcgtgacgaccgaacgtgcacgctgattgccggtctt
gacgaatcccgcgggttcacccacatccgcaccgactgcaaggagaacctcctcttcgtc
ctgccggaagcacccgcccgtgaattcaaggatggcgacaccgtcgaattcggaagattc
gccgtcatagaacgcaccgacgcggaggacgtggacaaggcgaccgaggccgccttcgat
cgctggttcgaactaaacggcatccaagcccgcacttgcaaaccggcctgcggatatacc
acctggtaccgtcattacggacgcatcaatgagaccgtcctgtgcagggatttcgacgcc
gtcagaagcgtgttcgagcgcgtcgacgcttcgggattcgaacgtgtattccaaatcgac
gacggtttctgcaaaattggagactggctggatgtcgatcggaaatgcttcccagccggt
ccagcaccaatggcgcagcacatctccagaaaaggattcacccccggcatctggctcgcc
ccgttcgccgttgagaaagacgccagaatcggccacgagcaccccgactgggtgctttgc
gacgagaaaggcaacgccgttaccattggcagcaactggagcggcgcatatgccctcgac
acccgcaacccagaagttcgcgcctacgtaaccgaggtaattcgcacctacacccaggac
tggggattcaaactgctgaagctcgacttcctgtatgcagcctgcatgattccccatgac
ggcatgaatcgcggcgagctcatggccgatgccatgcgccttttgagggatgccgctgga
gaagacgtgcttatcgacggatgcggcgtgcccttggccagcgcattcgggctggtcgac
tactgccgaatcagctgcgacgtcggaaacgactgggacgacctgcccagccgccgcatg
ctgcaccgcgagcgcgtcagcaccaaacacagcgtttccaacaccgtatggcgcgcacat
ctgaacaggcgagccttccgcaacgactctgacgtcgtctatctgagaaccgacgtgcaa
ctgaacatggagcagcgcaccatgctgctcgatcgcagtgcggtgttcagcggcgtactg
ttcacctctgacaacatgggtgcctgggacgacaatcagattgaacgttggcagaacgcc
atcgatctcatgagattggccaaccgatga

DBGET integrated database retrieval system