KEGG   Slackia heliotrinireducens: Shel_07040Help
Entry
Shel_07040        CDS       T00981                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
shi  Slackia heliotrinireducens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:shi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820222..820815
Genome map
AA seq 197 aa AA seqDB search
MIAFLNGRVAGHTTDTAFIEVNGVGFAVGMPASDLAKLPERGEEVLVHTYLAVREDAMAL
YGFLTQDEKRFFEKLIGVSGVGPKVALAALSVYKPEELANAIAAGDVKAVSMIPGVGKKT
AQRMILELKGSFSDENMQSLFDQETAEATRRLEGAREALLSMGFSSAEADLALKDAPEEL
HTDSALIQYALRRLGSL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttttttgaacggacgcgtcgccgggcatacgacggatacggcgtttatcgaa
gtgaacggcgtgggttttgccgtcggcatgcccgcgagcgatttggcgaaacttcccgaa
aggggagaagaggtgctggtgcacacctatttggctgtgcgcgaagacgccatggcgctc
tacggttttcttacgcaggatgagaagcgtttcttcgagaaactcatcggcgtttcgggg
gtggggccaaaagttgcgcttgcagcgctcagcgtgtacaagccggaagagctggccaat
gccatcgcagcgggggatgtcaaggccgtgtccatgatcccgggtgtcggcaagaaaacc
gcccaacgtatgattctggagctgaagggcagcttctcggatgagaatatgcagtcgctg
ttcgaccaagagacggcggaggcaacaagacgtttggaaggcgctcgggaagcgttgctt
tccatggggttctcgtccgccgaagcggatttggctttgaaagatgcgccggaagagctg
cataccgattcggcgctgatacaatatgcattacgccgcttgggctctctgtaa

DBGET integrated database retrieval system