KEGG   Slackia heliotrinireducens: Shel_08040Help
Entry
Shel_08040        CDS       T00981                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
shi  Slackia heliotrinireducens
Brite
Enzymes [BR:shi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Shel_08040
Transfer RNA biogenesis [BR:shi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Shel_08040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(930748..932559)
Genome map
AA seq 603 aa AA seqDB search
MEALLLDILETLRLCDEPLSSEELERFIRKHNQNIKRNEDHFSKKKVLAFYRKTKANDPD
RWASWNIDPALEDRLERTLRLKPRRTASGVATVTVMAKPWPCSSNCLYCPNDLKMPKSYL
SDEPVCQRAERSWFDPYLQMTSRIRALTGMGHVTDKVEVIILGGTWCDYPQEYQTWFVCE
LFRALNDGDAAEAHAKERRAWYRSTGLSNDRDRLKSIAAPLQEQVNDGRLTFNQAFHKLY
DENPAWQRIASMQKASMEELERQHRINENAAHRVVGLVVETRPDTITPESLRLIRRMGAT
KIQMGIQSLDGDILRKNLRVSSATDTRHAFELVRLYGFKIHAHIMVNLYGSSPEQDKHEY
LAFTRDEAYKPDEVKLYPCMLVDGTGLKKHYLNGSWAPYSDEELLDVLVQDTLATPPYTR
ISRMIRDISAHDIMAGNKHGNLRQLVEQMVAKTGEPVHEIRYREINNADMDDDTVHLEDV
AYTTRVSDEHFLQWVTPSGAIAGFLRLSLPHAEYVQEHADELAVLPGEAMIREVHVYGKV
SGIGTAGTAAQHRGLGKKLVARACDIASDAGFSAINVISAVGTREYYRKQGFSDNGLYLT
KAL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggaagcactgctgttggacatattggaaacattgcgcctgtgcgacgaaccgctcagc
tcagaggagttggaacgtttcatccgcaagcacaaccagaacatcaagcgcaacgaggac
catttttccaagaagaaggtcctggcgttctatcggaagacgaaggccaacgacccggac
cgctgggcgtcttggaacatcgaccccgcccttgaagacaggctggaacgtacgctgcgc
ctgaaaccgcggcgcaccgcctccggcgtggccaccgtcaccgtcatggcgaagccttgg
ccctgctccagcaactgcctgtactgccccaatgacctgaagatgccgaagagctatctg
tccgacgaaccggtatgccagcgtgccgagcgcagctggttcgacccgtacctgcagatg
acgtcccgcatccgggcgctcaccggcatgggacacgtcaccgacaaggtggaggtcatc
atcctgggaggcacctggtgcgactacccgcaggagtaccagacctggttcgtctgcgag
ctgttccgcgccctcaacgacggcgacgccgcggaggcgcatgccaaagagcgccgcgcc
tggtaccgctcgaccgggctttccaacgaccgggatcgcctgaaaagcatcgccgcgcct
ttgcaggaacaggtgaacgatggcaggcttaccttcaaccaggcatttcataaactgtat
gacgaaaaccccgcatggcagcgcatcgcctcgatgcagaaggcgtccatggaagagctg
gagcgccagcaccgcatcaacgagaatgcggcgcaccgtgtggtgggcctggtggtggag
acgcgacccgataccatcactccggaaagccttcggcttatccgccgcatgggcgccacg
aaaatccaaatgggcatccagagcctagacggggacatcctgcgcaagaatctgcgggtc
agcagcgccacggacacccgccacgccttcgagctggtgcgcctctacgggttcaaaatc
cacgcccacatcatggtaaacctttacgggtcctcgcctgagcaggacaaacacgaatac
cttgccttcacgcgggacgaagcgtataagcccgacgaggtgaagctgtacccctgcatg
ctggtggacggcacggggctgaagaagcattacctgaatggcagctgggcgccctattcg
gacgaagagctgctggacgtgctggtccaagacacgcttgccaccccgccctacacccgc
atctcgcgcatgatcagggacatctcggcccatgacatcatggcgggcaacaagcacggc
aacctgaggcagcttgtggagcagatggtggccaagaccggagagccggtgcatgagatc
cgctaccgtgaaatcaacaatgcagacatggacgacgacaccgtgcatctggaagacgtg
gcgtacacgaccagagtttccgacgaacacttcctgcaatgggtcaccccgtcaggagct
attgcggggttcctgcggctgtcgctgccgcatgccgagtacgtgcaagaacacgccgat
gagcttgccgtgttgcctggcgaagctatgatccgcgaagtgcacgtgtacggaaaggtg
tcaggcatcggaaccgcaggcacagcggcccagcacaggggcctcggcaagaagctggtg
gcccgagcgtgcgacatcgcctccgatgcaggcttttccgccatcaacgtgatcagcgcg
gtaggcacgcgggaatactaccgcaagcaggggttttccgacaacggtctgtacctcacc
aaggcgctgtag

DBGET integrated database retrieval system