KEGG   Slackia heliotrinireducens: Shel_10130Help
Entry
Shel_10130        CDS       T00981                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shi  Slackia heliotrinireducens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:shi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:shi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:shi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157192..1157962
Genome map
AA seq 256 aa AA seqDB search
MARKPLMIGNWKMNKTPAESVVLSQGISNRYNRKWDKVGVVLCPPSIDLRPVVTVLDYDK
SLIEVGAQNVHWEPSGAFTGEISIPMLKDVGATWCIVGHSERREMFAETDETVNLKVRAL
VDARLHPIVCVGESLAVRDAGTTIGFVTDQVRAAFAGLEPAEAALAVVAYEPIWAIGTGR
TATPEQAQEVCAAIRATLADMFGTETAQSMRILYGGSMKPANVDMFMPCEDIDGGLIGGA
ALKVEDFTALVEAAGK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaaacctttgatgatcggcaactggaaaatgaacaagaccccggccgaaagc
gtcgtgctttcccagggtatctccaaccgctacaaccgcaagtgggacaaggtcggcgtg
gtgctgtgcccgccgtccatcgacctgcgtccggtggtcaccgtgttggactatgacaag
tccctcatcgaggtgggcgcccagaacgtgcattgggagcccagcggtgccttcacgggc
gagatcagcatccccatgttgaaggacgtgggcgccacctggtgcatcgtgggccactcc
gagcgccgcgagatgttcgccgagaccgacgagaccgtgaacctcaaggttcgcgccctg
gtcgacgcccggctgcatcccatcgtctgcgtaggggagagcctggccgtccgcgacgcc
ggcaccaccatcggcttcgtgaccgaccaggtccgcgccgcgttcgccggcctggagccc
gccgaggccgcccttgccgtggtcgcctacgagcccatctgggccatcggcacgggccgc
accgccacgcccgagcaggcccaggaagtctgcgccgccatccgcgccacgctggccgac
atgttcggtacggaaaccgcccaaagcatgcgcatcctgtacggcggctcgatgaagccc
gccaacgtggacatgttcatgccctgcgaagacatcgacggcggcctgatcggcggagcc
gccctgaaggtggaggacttcaccgcactggtggaggcggcaggcaagtag

DBGET integrated database retrieval system