KEGG   Slackia heliotrinireducens: Shel_10130Help
Entry
Shel_10130        CDS       T00981                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shi  Slackia heliotrinireducens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shel_10130
   01230 Biosynthesis of amino acids
    Shel_10130
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shel_10130
   00051 Fructose and mannose metabolism
    Shel_10130
   00562 Inositol phosphate metabolism
    Shel_10130
Enzymes [BR:shi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shel_10130
Exosome [BR:shi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shel_10130
  Exosomal proteins of bladder cancer cells
   Shel_10130
  Exosomal proteins of melanoma cells
   Shel_10130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157192..1157962
Genome map
AA seq 256 aa AA seqDB search
MARKPLMIGNWKMNKTPAESVVLSQGISNRYNRKWDKVGVVLCPPSIDLRPVVTVLDYDK
SLIEVGAQNVHWEPSGAFTGEISIPMLKDVGATWCIVGHSERREMFAETDETVNLKVRAL
VDARLHPIVCVGESLAVRDAGTTIGFVTDQVRAAFAGLEPAEAALAVVAYEPIWAIGTGR
TATPEQAQEVCAAIRATLADMFGTETAQSMRILYGGSMKPANVDMFMPCEDIDGGLIGGA
ALKVEDFTALVEAAGK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaaacctttgatgatcggcaactggaaaatgaacaagaccccggccgaaagc
gtcgtgctttcccagggtatctccaaccgctacaaccgcaagtgggacaaggtcggcgtg
gtgctgtgcccgccgtccatcgacctgcgtccggtggtcaccgtgttggactatgacaag
tccctcatcgaggtgggcgcccagaacgtgcattgggagcccagcggtgccttcacgggc
gagatcagcatccccatgttgaaggacgtgggcgccacctggtgcatcgtgggccactcc
gagcgccgcgagatgttcgccgagaccgacgagaccgtgaacctcaaggttcgcgccctg
gtcgacgcccggctgcatcccatcgtctgcgtaggggagagcctggccgtccgcgacgcc
ggcaccaccatcggcttcgtgaccgaccaggtccgcgccgcgttcgccggcctggagccc
gccgaggccgcccttgccgtggtcgcctacgagcccatctgggccatcggcacgggccgc
accgccacgcccgagcaggcccaggaagtctgcgccgccatccgcgccacgctggccgac
atgttcggtacggaaaccgcccaaagcatgcgcatcctgtacggcggctcgatgaagccc
gccaacgtggacatgttcatgccctgcgaagacatcgacggcggcctgatcggcggagcc
gccctgaaggtggaggacttcaccgcactggtggaggcggcaggcaagtag

DBGET integrated database retrieval system