KEGG   Slackia heliotrinireducens: Shel_11640Help
Entry
Shel_11640        CDS       T00981                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
shi  Slackia heliotrinireducens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Shel_11640
Enzymes [BR:shi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Shel_11640
Exosome [BR:shi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shel_11640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1341055..1342047
Genome map
AA seq 330 aa AA seqDB search
MTEYGKFPAYRPRRMRANATVRSFIRETQISAADFIYPLFVMPGEGKHEEVPSMPGVYQV
SLDTLPAEIDELTDCGVPAVLLFGLPSHKDEVGSEAYDEHGIVQEACRVIKAHAPEMYVI
TDVCLCEYTSHGHCGKLDETGYVMNDPTLELLAAEAVSHAAAGADMVAPSDMMDGRIAAI
RSALDQAGFENVPIMSYSTKYASGFYGPFRDAADSAPAFGDRRAYQMDPANVEEGVREAA
LDIAEGADFVMVKPALPYLDVLNRVKREFNFPTAAYNVSGEYAMIKAAAANGWIDEKRVV
LELLTSIKRAGADVIITYHAKEAARWLSEE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtacggaaaattccctgcgtaccgtccgcgccgcatgcgcgccaacgccacg
gtgcgctccttcatccgcgagacgcagatttccgccgcggacttcatctacccgctgttc
gtcatgcccggcgaaggcaagcacgaggaggttccctccatgcccggcgtgtaccaggtg
tcgctggacacgctgcccgccgagatcgacgagcttaccgattgcggcgtgcccgcggtg
ctgctgttcggcctgccgtcccacaaggacgaggtgggaagcgaagcctacgacgagcac
ggcatcgtgcaggaggcatgccgcgtgatcaaggcccatgcgcccgaaatgtacgtgatc
accgacgtgtgcctgtgcgagtacaccagccacggccattgcggcaagctggacgagacg
gggtacgtgatgaacgaccccacgcttgagcttctggccgccgaggccgtaagccatgct
gccgccggagccgacatggtggctccctccgacatgatggacgggcgcatcgccgccatc
cgttccgcccttgaccaggccggattcgagaacgtgcccatcatgtcctattccaccaag
tacgcgagcggcttctacgggcccttccgcgacgccgccgattcggccccggccttcggc
gaccgccgcgcctaccagatggatcccgccaacgttgaggaaggcgtgcgcgaagccgcc
ctggacatcgccgagggcgccgacttcgtcatggtcaagcccgcgttgccttacctggac
gtgctgaaccgcgtgaagcgcgagttcaatttccccacggcggcctacaacgtgtcgggc
gaatacgccatgatcaaggccgcggctgccaacggctggatcgacgagaagcgcgtcgtg
ctggagcttctgacctccatcaagcgcgccggcgcagacgtaatcatcacctatcatgcg
aaagaagctgcacgttggctttctgaggaatag

DBGET integrated database retrieval system