KEGG   Slackia heliotrinireducens: Shel_11910Help
Entry
Shel_11910        CDS       T00981                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
shi  Slackia heliotrinireducens
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Shel_11910
Enzymes [BR:shi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Shel_11910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1373700..1374212
Genome map
AA seq 170 aa AA seqDB search
MNLAMHRVGDAWLSVSATTRKPRKGEVDGQHYFFVSNDEFDAMVEQDRLLEWAQVHANRY
GTPRETVEQHIAAGNQVILEIDVQGALQVREKMPSAKLVFIEPPSMDVLESRLRGRGTEA
EDVIALRMKNAETELALKNEYDISFINDDLDECADALVAYIEQSAEEKDE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctggccatgcaccgtgtaggcgatgcatggctttccgtttctgccaccacgcgc
aaaccgcgcaagggggaagtggacgggcagcactacttcttcgtgtccaacgatgaattc
gacgccatggtcgaacaggaccgcctgctggagtgggcacaggtccacgccaaccgttac
ggcactccgcgggaaaccgttgagcagcacattgcggctggcaaccaggtcattctggaa
atcgacgtccaaggcgccctgcaggtccgcgagaagatgccttccgcaaagctggtgttc
atcgagccgccgtccatggacgtgctggaaagccgcctgcgcggccgcggaaccgaagcg
gaggacgtcatcgccctgcggatgaagaacgcggaaaccgagcttgcgctcaaaaacgag
tacgatatcagtttcatcaacgacgacctcgacgaatgtgccgatgctctggtagcatac
atagagcagtcggccgaagagaaggacgagtaa

DBGET integrated database retrieval system