KEGG   Slackia heliotrinireducens: Shel_13030Help
Entry
Shel_13030        CDS       T00981                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
shi  Slackia heliotrinireducens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:shi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:shi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1494819..1495898
Genome map
AA seq 359 aa AA seqDB search
MEEAKQKVAVIKIGSSTLTTADGQADQMFLADLAHQVWRMRNKGWGVVIVSSGAIPCGLR
TMGLPIKRPKDMPTVQAAASVGTRVLLAAYDQAFSPYSILTSLVLLTRRDTADRNAYLHA
RDTFLRLIELGVVPIVNENDTVSVEQIKFGDNDTLAALVACLIGADRVVIMSDIDGLYTA
NPQTNPDAEIIRVVDRITPEIMQGASGAGSSVGSGGMVTKLTSARVLGAAGISLVICHGR
AEEVIVRSLEDEPRIGTLFSAHEPRHEITPRKLWIALGNSTKARITVDRGAAAALLGHGK
SLLAAGIKHVDNDFDEGDVLDVIDMDGFVIARGLAKCSSEGLNKDSGVVIHRDELMVFE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagcgaagcagaaggtcgccgtcatcaagatcggttcgtccacgctgacgacc
gcagacggtcaagccgaccagatgttcctggcggaccttgcgcatcaggtctggcgtatg
cgcaacaagggatggggcgtggtcatcgtaagctccggcgccattccgtgcgggcttcgc
accatgggcctgcccatcaagcgaccgaaagacatgccgacggtccaggctgcggcaagc
gtcggcacccgcgtactgctggccgcgtatgaccaagcgttttcgccctacagcatcctc
acatcgctggtcctgctcacgcgccgcgacacggcagaccgcaacgcctacctgcacgcc
cgcgataccttcctgaggcttatcgagctgggcgtggtgcccatcgtcaacgagaacgac
acggtgtccgtcgaacagatcaagttcggcgacaacgatacgctggcggcactggtcgcc
tgcctgatcggcgccgaccgtgtggtcatcatgtccgacatcgacggcctgtacacggct
aatcctcagaccaaccccgatgccgaaatcatccgcgtagtggaccgcatcacccccgaa
atcatgcagggtgcctctggcgccggcagcagcgtgggatcgggcggtatggtgaccaag
ctcacttcggcacgcgtgctgggtgcagcgggcatctcgctggtcatctgccacggccgc
gccgaggaggtcatcgtacgcagccttgaggacgagcctcggatcggcaccctgttttcg
gcccacgagccccgtcacgaaatcacgccgcgcaagctgtggattgccctgggcaactcc
accaaggcccgcataacggtggacaggggcgccgctgcagccctgcttgggcacggcaaa
tcgctgctggcggccgggatcaagcacgtggacaacgacttcgacgagggcgacgtgctg
gatgtgatcgacatggacggcttcgttatcgcccgcggtctggccaagtgctcgtccgag
ggtctgaacaaggattcgggcgtggtcatccaccgcgacgagctgatggtgttcgagtaa

DBGET integrated database retrieval system