KEGG   Slackia heliotrinireducens: Shel_15280Help
Entry
Shel_15280        CDS       T00981                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
shi  Slackia heliotrinireducens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shel_15280
  Amino acid metabolism
   00340 Histidine metabolism
    Shel_15280
Enzymes [BR:shi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Shel_15280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1749538..1750911)
Genome map
AA seq 457 aa AA seqDB search
MRNITLAQGEYLKAGQLPRQGVLPAKVVTAAAGIVEEVRERGDAALRDFCLKFDGVEMDD
FRVDPSAMDAAIDRVDLEFVEAVKKAAAQIRDFHEREVRQSWITTRPDGTILGQKVTPLS
AAGVYVPGGRAQYPSTVLMDVIPAKVAGVEKIVMVTPPQKEGGISPYTLAAAKVAGVDEI
YAVGGAQAIAAVAYGTESIPKVDKIVGPGNAFVAAAKRIVSGDVGIDMVAGPSEVCVLAD
DSANPVVVAADLMAQAEHDPLAACYLVTSSAELAQAVQEKLPAMVAASPRAEITAASLDN
EGVVIVAPTLDQAIEAVNVIAPEHLELHCDDAMSLLGRIKNAGAIFIGHWSSEPLGDYVA
GPNHTLPTGGTAVFSNPLGVDDFVKHSSIINYTKEGLEIDGPAVQVMAQAEGLWAHALSV
GVRRKMLADGEEALNAVTPDELFAIAWPRILNTPKEA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacatcacgcttgcgcagggcgagtacctgaaggccggacagctgccccgtcag
ggcgttctgcctgccaaggtggttaccgccgccgcaggcatcgtcgaggaggtgcgcgag
cgcggtgacgcggccctgcgcgatttctgcctgaaattcgacggtgtcgaaatggacgat
ttccgtgtggacccgtctgccatggacgcggccatcgaccgcgtggacctcgaattcgtc
gaagccgtcaaaaaggctgcggcccagattcgcgacttccacgagcgtgaggtccgccag
tcctggatcaccacgcgtccggacggcaccatcttgggtcagaaggtcacgccgctttct
gccgccggcgtatacgtgccgggcggccgtgcccagtatccttccaccgtccttatggac
gtcattccagccaaggtcgccggcgtcgagaagatcgttatggtgacgcctccgcagaag
gagggcggcatttcgccatacacgttggcggctgccaaggtcgccggcgtagacgaaatc
tacgctgttggcggagcccaggccatcgccgcagtggcgtacggcaccgaatccatcccc
aaggtggacaagatcgtgggccccggcaatgcgttcgtggccgcagccaagcgcatcgtc
tccggcgatgtgggcatcgacatggtggcgggcccctccgaggtctgcgtgctggccgat
gacagcgccaacccggtggttgtggctgccgaccttatggcccaagccgaacacgacccg
ctggccgcatgctatctggttacgagcagcgccgagctggcccaggccgtgcaggagaag
cttcctgccatggtggccgcaagcccacgtgctgaaatcaccgcagcatcgcttgacaac
gagggcgtcgtcatcgtcgcgcccacgttggaccaggccatcgaggccgtgaacgtcatc
gcgcccgagcatctggagctgcattgcgacgatgccatgagccttctgggccgcatcaag
aacgcaggcgccatcttcatcgggcactggagctccgagccgctgggcgactacgttgcc
ggtcccaaccacacgctgcccacaggcggcaccgcggtgttctcgaacccgctgggtgtg
gacgatttcgtgaagcattcctccatcatcaactacacgaaggagggtctggagatcgac
ggccctgccgtgcaggtcatggcacaagctgaaggcctgtgggcccatgccctttccgtc
ggcgtgcgtcgcaagatgctggccgatggggaagaggccctcaacgccgtgacgcccgac
gagctgttcgccatcgcctggccccgcatcctgaacacgccgaaggaggcataa

DBGET integrated database retrieval system