KEGG   Slackia heliotrinireducens: Shel_16070Help
Entry
Shel_16070        CDS       T00981                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
shi  Slackia heliotrinireducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shel_16070
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shel_16070
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shel_16070
Enzymes [BR:shi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shel_16070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1805535..1807007
Genome map
AA seq 490 aa AA seqDB search
MASIYHSTRGTDQVCGAKEAVLNGIAPDGGLYVTDALGSAALDLNKVVGQTFQQIAADVL
ATLLDDYTREEIESCVDAAYVGTFDAPEVTPLVPVEDQYVLELFHGPTSAFKDVALQMLP
QLMSRATGEQHIMILTATSGDTGKAALAGFANTPGLGISVFFPHGGTSAIQRLQMVTQPG
DNVAVAAVRGNFDDTQSTVKAIFADKELAARLAEKNIVLSSANSINVGRLAPQVTYYFDA
YAQLVRAGKINVGDEVEFCVPTGNFGDVLAGYFAKNMGLPVAKLIVASNANNILTDFLTT
GVYDRNRPFHKTISPSMDILISSNLERLLYYASKGDTAYVAQLMADLKETGRYEVREDIL
AGIRELFDCGCADDDMARESMAECYKQTGYVLDPHTAVGWNVSKRIPCKAAARVVLSTAS
PFKFCRDVCDALGFNAEGSDFDCLRELEKQTGLAAPAALAALESADVRFEDVIAKDEMPA
FVEAKCGELL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgatttaccacagcacccgcggcaccgaccaggtttgcggcgccaaggaagcc
gtcttgaacggcatcgcccccgacggcggcctgtacgtcaccgacgcactgggcagcgca
gccctcgatttgaacaaggtcgtcggccagacgttccagcagatcgccgccgacgtgctg
gccaccctgcttgacgattacacccgcgaagaaatcgagtcctgcgtcgacgccgcctac
gtcggcaccttcgacgcgcccgaggtcacgcctctggtacccgtggaagaccagtacgtg
ctggagctcttccacggtcccaccagcgccttcaaggacgttgccttgcagatgctgccg
cagctcatgagccgcgccaccggcgagcagcacatcatgattctgaccgccaccagcggc
gacactggcaaagcggccctggcgggcttcgcgaacacgccgggcctgggcatctcggtc
ttcttcccccacggcggcaccagcgccatccagcgcctgcagatggtcacccagccgggc
gacaacgtggcagtggctgccgtccgcggtaacttcgacgacactcaaagcaccgtcaaa
gccattttcgccgacaaggagctggcagcgcgtctggccgaaaagaacatcgtcctgtcc
agcgccaactccatcaatgtgggccgtctggcacctcaggtcacctattacttcgacgcc
tatgcgcagctggtccgcgccggcaagatcaacgtgggtgacgaagtcgagttctgcgtg
cccaccggcaacttcggcgacgtgctggcaggctacttcgccaagaacatgggcctgccc
gtagccaagctcatcgtggccagcaacgccaacaacatcctcaccgactttttgaccacg
ggcgtctacgaccgcaaccgcccgttccacaagaccatctcgccttcgatggacatcctc
atctcgtccaacctggagcgcctgctgtactacgcgtccaagggcgacaccgcatatgtg
gcccagctcatggccgacctgaaggagaccggccgctacgaggtccgcgaagacatcctg
gccggcatccgcgagctgttcgactgcggctgcgccgacgacgacatggcccgcgagtcc
atggccgaatgctacaagcagaccggttatgtgctggacccgcacaccgccgtgggctgg
aacgtgtccaagcgcatcccgtgtaaagccgcggcgcgcgtggtgctgtccaccgcaagc
cccttcaagttctgccgcgacgtatgcgacgctcttggtttcaacgccgaaggctccgac
ttcgactgcctgcgtgaacttgaaaaacagaccggacttgccgcccccgccgcactggcc
gcgctcgaatccgccgacgtgcgcttcgaagacgtcatcgccaaggacgagatgccggcg
ttcgtcgaagccaaatgcggtgagctgctgtga

DBGET integrated database retrieval system