KEGG   Slackia heliotrinireducens: Shel_16070Help
Entry
Shel_16070        CDS       T00981                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00260  Glycine, serine and threonine metabolism
shi00750  Vitamin B6 metabolism
shi01100  Metabolic pathways
shi01110  Biosynthesis of secondary metabolites
shi01120  Microbial metabolism in diverse environments
shi01230  Biosynthesis of amino acids
Module
shi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shel_16070
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shel_16070
Enzymes [BR:shi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shel_16070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Nitrate_red_del
Motif
Other DBs
NCBI-ProteinID: ACV22626
UniProt: C7N6U1
Position
1805535..1807007
Genome map
AA seq 490 aa AA seqDB search
MASIYHSTRGTDQVCGAKEAVLNGIAPDGGLYVTDALGSAALDLNKVVGQTFQQIAADVL
ATLLDDYTREEIESCVDAAYVGTFDAPEVTPLVPVEDQYVLELFHGPTSAFKDVALQMLP
QLMSRATGEQHIMILTATSGDTGKAALAGFANTPGLGISVFFPHGGTSAIQRLQMVTQPG
DNVAVAAVRGNFDDTQSTVKAIFADKELAARLAEKNIVLSSANSINVGRLAPQVTYYFDA
YAQLVRAGKINVGDEVEFCVPTGNFGDVLAGYFAKNMGLPVAKLIVASNANNILTDFLTT
GVYDRNRPFHKTISPSMDILISSNLERLLYYASKGDTAYVAQLMADLKETGRYEVREDIL
AGIRELFDCGCADDDMARESMAECYKQTGYVLDPHTAVGWNVSKRIPCKAAARVVLSTAS
PFKFCRDVCDALGFNAEGSDFDCLRELEKQTGLAAPAALAALESADVRFEDVIAKDEMPA
FVEAKCGELL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgatttaccacagcacccgcggcaccgaccaggtttgcggcgccaaggaagcc
gtcttgaacggcatcgcccccgacggcggcctgtacgtcaccgacgcactgggcagcgca
gccctcgatttgaacaaggtcgtcggccagacgttccagcagatcgccgccgacgtgctg
gccaccctgcttgacgattacacccgcgaagaaatcgagtcctgcgtcgacgccgcctac
gtcggcaccttcgacgcgcccgaggtcacgcctctggtacccgtggaagaccagtacgtg
ctggagctcttccacggtcccaccagcgccttcaaggacgttgccttgcagatgctgccg
cagctcatgagccgcgccaccggcgagcagcacatcatgattctgaccgccaccagcggc
gacactggcaaagcggccctggcgggcttcgcgaacacgccgggcctgggcatctcggtc
ttcttcccccacggcggcaccagcgccatccagcgcctgcagatggtcacccagccgggc
gacaacgtggcagtggctgccgtccgcggtaacttcgacgacactcaaagcaccgtcaaa
gccattttcgccgacaaggagctggcagcgcgtctggccgaaaagaacatcgtcctgtcc
agcgccaactccatcaatgtgggccgtctggcacctcaggtcacctattacttcgacgcc
tatgcgcagctggtccgcgccggcaagatcaacgtgggtgacgaagtcgagttctgcgtg
cccaccggcaacttcggcgacgtgctggcaggctacttcgccaagaacatgggcctgccc
gtagccaagctcatcgtggccagcaacgccaacaacatcctcaccgactttttgaccacg
ggcgtctacgaccgcaaccgcccgttccacaagaccatctcgccttcgatggacatcctc
atctcgtccaacctggagcgcctgctgtactacgcgtccaagggcgacaccgcatatgtg
gcccagctcatggccgacctgaaggagaccggccgctacgaggtccgcgaagacatcctg
gccggcatccgcgagctgttcgactgcggctgcgccgacgacgacatggcccgcgagtcc
atggccgaatgctacaagcagaccggttatgtgctggacccgcacaccgccgtgggctgg
aacgtgtccaagcgcatcccgtgtaaagccgcggcgcgcgtggtgctgtccaccgcaagc
cccttcaagttctgccgcgacgtatgcgacgctcttggtttcaacgccgaaggctccgac
ttcgactgcctgcgtgaacttgaaaaacagaccggacttgccgcccccgccgcactggcc
gcgctcgaatccgccgacgtgcgcttcgaagacgtcatcgccaaggacgagatgccggcg
ttcgtcgaagccaaatgcggtgagctgctgtga

DBGET integrated database retrieval system