KEGG   Slackia heliotrinireducens: Shel_17010Help
Entry
Shel_17010        CDS       T00981                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
shi  Slackia heliotrinireducens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shel_17010
Enzymes [BR:shi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Shel_17010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1914454..1917024
Genome map
AA seq 856 aa AA seqDB search
MQACHNSRDVAYRLPYGAVQQGESVALSIDLWDAQGAIVRLRTWTAESGERIYPMDAVVE
LHGAVRHKVELAFDGAGIVWYHFIIQMADGRVLRYGACDGKTGGEGRLYDWEPPSFQLTV
CDPNGIAPSRDEDDLRRSQSMLGPVADFLLGRISAPELAEMIEALRENYPDETFRHALAF
LEGMDDDRLLGLFSGLPESELTLNDGGPLVLDDHHAGIAKGRLWCASLLQMLSPAGTRQT
ESCPVVHTDRDCQAIFDNARDLRETLPLFMDGTFSCFAANEDVLGFWRRGADGTSACVLV
NGSLQNAHDVFVPMTGEAVSEVIGGYDVPVCDASELDGRVDAPPKAQRYARVRLSQIGSA
VVYFHPTQRLQLPMDAGLGVLAHITSLPVSKNPNAPEASDKADAGRTAPAASEKAEAERD
PSGVPDKNPGTLGAPAREFVDWLAQAGARYWQVLPVNPTDEYGSPYAGISAFAGNTRLLE
RPSAPDTGDAADRDPDAYRRFCTREADWLEPYAAFMAIRQKLAATSDVEPLPWQDWPNAY
RSFDPSVIQADPELREHAERCRRAQFEFEQQWDDLRRYANARGVLIVGDMPIYVSADSAD
VWANPELFQLEPDGRPAAVAGCPPDAFAEEGQLWGNPVYNWDALRESGYDWWLRRLQRAF
RLYDFVRLDHFIGFSRYYRIPKGKPATEGNYCPGPGADLFRTAYEQFGPLPVIAEDLGSI
TPAVRALAAACGFPGMDVVQFADGNDPLSGWRPRPAKVAYTGTHDNQTLVGYVRKRYPDL
DCQAAVDRLMRDVVTCEAPVAVLPLQDLMGLDDDARMNTPGTSQGNWTWQADRQALRQTG
ATLHALVDMRNASLEA
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcctgccataattcgcgagacgtcgcgtaccgactgccttacggcgccgttcaa
cagggcgaatcggttgcgctttcgatagacctttgggacgcacaaggcgccatcgttcgg
ctgcgcacctggaccgccgaatcgggcgaacgcatataccccatggatgccgttgtagag
ctgcacggggccgtgcggcacaaggttgagctcgcattcgacggcgcgggcatcgtgtgg
taccacttcatcatccagatggcagacggccgcgtcctgcgctacggagcctgcgacggc
aagaccggaggcgaaggccgcctgtacgactgggagccgcccagcttccagctgaccgtg
tgcgacccgaacggcatcgccccgtcgcgggacgaagacgatctgcgccggagccaatcg
atgttgggtcccgtcgccgattttctgctagggcgaatttcggcacctgagctggccgaa
atgatcgaggcgctacgtgagaactaccccgatgaaaccttccgccatgcgctggcgttt
ctggaaggaatggacgatgaccgactgcttggattgttcagcggccttcccgaaagcgaa
ctgacattaaatgacggtggacccctggttctggatgaccaccatgcgggcatcgcgaaa
ggacgcttgtggtgcgcaagcctgctgcagatgctttcgccggctggcacgcgacagacg
gaatcgtgcccggtcgtgcacacggaccgcgactgccaggccattttcgacaacgcacgg
gacctgcgcgaaacgcttcccctatttatggacggaacgttctcctgctttgcggcgaac
gaagacgtgctgggcttttggcggcgcggggccgacgggacatcggcatgcgtcctggtc
aacggctcgcttcaaaacgcgcacgacgtgttcgtccctatgacgggcgaagcggtatcc
gaggtgataggcggctacgatgtgccggtgtgcgacgcctccgagctggacgggcgcgtc
gacgctccgccaaaagcgcagcggtacgcgcgggtgcgcctgtcccaaatcggctcggcc
gtggtgtatttccatcccacacaacggctgcagctgcccatggatgcagggctgggcgtg
ctggcgcatataacgagccttcccgtatcgaaaaacccgaatgctccggaggcgtccgat
aaagccgacgccggacgcaccgctccagccgcatccgagaaggccgaagccgaacgcgac
ccctcgggcgtacccgacaaaaacccaggcacattgggcgcgccggcgcgggagttcgtg
gattggctggcccaggcgggcgcgcggtactggcaggtgctgccggttaaccccaccgac
gagtacggcagcccttacgccggcataagcgccttcgccggcaacacacgtctgttggag
agaccgtcggcgcccgatacaggcgatgccgccgaccgcgaccctgatgcgtaccgcagg
ttctgcacacgcgaagccgactggctggaaccctatgcggcatttatggccatccgacag
aagctggccgcgacgtcggacgtcgaacccctcccctggcaggactggcccaatgcgtac
cgcagcttcgacccttccgtcattcaggccgatcctgaactgcgagaacatgccgaacgg
tgccgccgcgcccaattcgagttcgagcagcagtgggacgacctgcgccgatacgccaac
gcacgaggcgtgctcatagtaggcgacatgcctatatatgtaagcgcggacagcgccgac
gtgtgggccaaccccgagctgttccagctggaacccgacgggaggcccgccgccgtggca
ggctgccctccggatgccttcgccgaagagggccagctgtggggaaaccccgtctacaac
tgggacgctttgcgggaaagcggctacgactggtggctgcgccgtctgcagcgggccttc
aggctctacgatttcgtgcgcctggaccacttcatcgggttttcgcgctactaccgcatc
cccaaaggcaagccggccacggagggaaactactgcccgggcccgggcgcggacctgttc
cgcaccgcctacgaacagttcgggccactgcccgtgatcgctgaggatcttggctccatc
acgcctgccgtgcgcgcgctggccgccgcgtgcgggttcccgggcatggacgtcgtgcag
ttcgccgacggcaacgacccgctttcgggctggcgcccgcgccccgccaaggttgcctac
acgggcacccacgacaaccagacgctggtgggctacgtgcggaagcgctaccctgacctg
gactgccaggctgcggtggacaggctgatgcgggatgtggtcacctgcgaagcgcccgtg
gcggtgctgcccctgcaggacctgatgggactcgacgacgacgcgcgcatgaacaccccg
ggcacgtcgcagggcaactggacgtggcaggccgacaggcaggccctgcgccagacaggt
gctaccctgcatgcgctggtcgacatgagaaacgcttcgcttgaagcgtag

DBGET integrated database retrieval system