KEGG   Slackia heliotrinireducens: Shel_17320Help
Entry
Shel_17320        CDS       T00981                                 

Definition
(GenBank) uncharacterized conserved protein
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00010  Glycolysis / Gluconeogenesis
shi00030  Pentose phosphate pathway
shi00051  Fructose and mannose metabolism
shi00680  Methane metabolism
shi01100  Metabolic pathways
shi01110  Biosynthesis of secondary metabolites
shi01120  Microbial metabolism in diverse environments
shi01130  Biosynthesis of antibiotics
shi01200  Carbon metabolism
Module
shi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shel_17320
   00030 Pentose phosphate pathway
    Shel_17320
   00051 Fructose and mannose metabolism
    Shel_17320
  Energy metabolism
   00680 Methane metabolism
    Shel_17320
Enzymes [BR:shi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Shel_17320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ACV22751
UniProt: C7N766
Position
complement(1955202..1957112)
Genome map
AA seq 636 aa AA seqDB search
MTTIDMQTLEHLSETYPTAQAARAEAEASARQLADLKGAVVFASDVHGEYNAFDHILRSG
CGSIRQTIDSLFADELTEEERAELATLVYYPREKAELLLSQPEDQTTWLGKVLPQLAAVL
QAVAEGRPEALRREMPEGAADTIGALLAGDAEPALRAGDPAGIVEAVGTLIQRLSISHLH
MVGDVYDRGPSPELIMDMMMGYHSIDIQWGNHDVLWMGAALGQRGCVANVVRICARYGNF
PILEDSYGISMKPLVDFALETYKDDPCVGFAPKIKGDFTPEELARWSKIQKAIAYIQFKV
EAKLIAENPSFGLDDRNLLHLIDRERGTVVVDGVEYEVQDMVFPTVDWDDPYRLSDEESA
VMDYLEQAFMNCEKLQRHIRFFLDAGSFYKICGDFLLYHACVPLNADGSLKEVTVLGETY
KGRSLFDAMERYTRQAFDDPDPAKRKVGRDMIWYMWLGQGSPLFAKSKMATFEIYMIADK
AARKEVKNPYYSLLEDEQVLAGIFEDFGMDPAVSRIVSGHVPVKVKDGEDPVKCGGKAMI
IDGGFSRAYQSATGIAGFALVNDANGLRLGYLEPLESQQAAIERNLDIVPKWRTLAENES
PLHVGDTEYGLVLRDKIDALTRLAEAYEAGDMPERA
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgattgacatgcaaacccttgaacacttgagcgaaacgtatccgaccgcgcag
gccgctcgcgcagaggcggaagctagcgcccggcagctggccgacctcaagggcgcggtg
gttttcgcatccgacgtgcatggcgaatacaacgcgttcgaccacatcctgcgtagcggc
tgcggctccatccgccagacgatcgacagtctgttcgccgacgagctgaccgaagaggag
cgggccgaactggcaacgctcgtgtactatccccgcgagaaggcggagctgctcctgtcc
cagccagaagaccagacaacctggctgggcaaggtgttgccgcagctggcggctgtgctg
caagccgttgccgaaggacgccccgaggcgcttcgtcgcgagatgcccgaaggtgcagcc
gacacgatcggggccctgcttgcgggcgatgctgaacctgctcttagggcgggcgacccg
gcgggtatcgtggaggccgtgggcacgttgatccagcgcctgtcgatttcgcatttgcat
atggtgggcgacgtgtacgaccgcgggccgtcgccggaactcatcatggacatgatgatg
ggctaccactccatcgacatccagtggggcaaccacgacgtcctgtggatgggcgccgct
ttgggccagcggggctgcgtggccaacgttgtgcgcatctgcgcacgctacggcaatttc
cccattctggaggattcctacggcatcagcatgaaacccctggtggacttcgcgttggaa
acctacaaggacgacccctgcgtgggcttcgcgccgaagatcaagggcgatttcacgccc
gaggagctggcccgttggtcgaagatccagaaggccatcgcatacatccagttcaaggtg
gaggccaagcttatcgccgagaacccgtccttcggtctggacgaccgcaacctgctgcac
cttatcgaccgcgagcgcggcacggtggtggtggacggtgtggaatacgaggtccaggac
atggtgttcccgacggtggactgggacgacccgtaccgcctgtcggatgaggaatcggcc
gtgatggattacctcgagcaggccttcatgaactgcgagaagctccagcgccacatccgt
ttcttcctggatgcgggcagcttctacaaaatctgcggcgactttctgctgtaccacgcg
tgcgttccgctgaacgccgacggctctctgaaggaagtcaccgtgctcggcgaaacgtac
aagggccgttcgctgttcgacgccatggagcgctacacccgccaagcattcgacgaccct
gaccctgccaagcgcaaggtcggccgcgacatgatttggtacatgtggctcggccaaggc
tcgcccctgttcgcgaagagcaagatggccaccttcgagatttacatgatcgccgacaaa
gccgcccgcaaggaggtcaagaacccgtactactcgctgctcgaggacgagcaggtgctg
gcgggcatcttcgaggacttcggcatggatccggccgtctcgcgcatcgtgagcgggcat
gtgccggtgaaggtgaaggacggcgaagatcccgtgaaatgcggcgggaaggccatgatc
atcgacggcggcttctcgcgtgcgtatcagtccgctacgggcattgccgggtttgccctg
gtcaacgatgcgaacgggttgcgtctgggctatctggaaccgctggagtcgcagcaggcc
gccatcgagcgcaacctggacatcgtgccgaaatggcgtacgcttgccgaaaacgaatcc
ccgctacacgtgggcgataccgaatacggcctggtactgcgcgacaagatcgatgcactg
actcgcttggccgaagcctacgaggcgggcgatatgcccgagcgcgcgtaa

DBGET integrated database retrieval system