KEGG   Slackia heliotrinireducens: Shel_17330Help
Entry
Shel_17330        CDS       T00981                                 

Definition
(GenBank) acyl-CoA synthetase/AMP-acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00010  Glycolysis / Gluconeogenesis
shi00620  Pyruvate metabolism
shi00640  Propanoate metabolism
shi00680  Methane metabolism
shi01100  Metabolic pathways
shi01110  Biosynthesis of secondary metabolites
shi01120  Microbial metabolism in diverse environments
shi01130  Biosynthesis of antibiotics
shi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shel_17330
   00620 Pyruvate metabolism
    Shel_17330
   00640 Propanoate metabolism
    Shel_17330
  Energy metabolism
   00680 Methane metabolism
    Shel_17330
Enzymes [BR:shi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Shel_17330
Lipid biosynthesis proteins [BR:shi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Shel_17330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACV22752
UniProt: C7N767
Position
complement(1957744..1959492)
Genome map
AA seq 582 aa AA seqDB search
MDYILKKYCPRITFESYEDFYENFRIDVPEDFNFAYDVVDEWARVEPDKMALLWCNDDGE
EREFTFTDISRLSNRAANAFTKMGIVKGDVVMCILRRRWEYWVIAMALCKIGATIIPATL
QLTTKDIAYRANSVGIKALVCVNDDYVCTQAEGAVKQAPSVEQKVVVAGEREGWLSFDHM
IADESEEWTRPEPGSPQATKSDELMLIYFTSGTTGNPKAVMHNFAHPLGHIITAKYWQQV
RENGLHMSVTDSGWAKFGWGKIYGQWLSGAEIFCYDMMKFIPAKLLQHMQDYDLKTFCAP
PTMYRFMLQEDVASYDLSSIENFATAGEPLNAEVSIKWEQLTGKKIREGFGQSEGPVLVA
TFPWIEPRPGALGKPSPLLNIKLLDDDGREVEDGEEGAICITRLKEAYPPGLFVGYFGLP
EQTAETVGGEYYNLHDMAWRDVEGYISFVGRNDDVIKCSGYRIGPFEVESALVKHDAVVE
CAVTAAPDPIRGKVVKATIVLARGYEPSPELTKELQNWVKKETAPYKYPRIVEYVDELPK
TVGGKIKRKLIRQQDGITDDDKIHSIGSDRSAVDESWKSNES
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggattacatcctgaagaaatactgtccccggatcaccttcgagagctacgaggacttc
tacgagaacttccgcatcgacgtgcccgaggatttcaacttcgcatacgacgtcgtggac
gaatgggccagggtcgagcccgataagatggcgcttctgtggtgcaacgacgacggggag
gaacgcgagttcacgttcacggacatctcccgactgtcgaaccgtgcggccaacgccttc
accaagatgggcatcgtgaaaggcgacgtggtcatgtgcatcctgcgccgccgctgggag
tactgggtcatcgccatggccctgtgcaagatcggcgccaccatcattcccgccacgttg
cagctgaccaccaaggacatcgcataccgtgccaacagcgtcggcatcaaggcgctggtc
tgcgtcaacgacgattacgtttgcacccaggcggaaggtgccgtcaagcaggcgccctcc
gtggagcagaaggtcgtcgtcgccggcgagcgcgagggctggctgtccttcgaccacatg
atcgccgacgagtccgaggaatggacccgccccgagcccggcagcccccaggccacgaag
tccgacgagctcatgctcatctacttcaccagcggcaccacgggcaaccccaaggcggtc
atgcataatttcgcacacccgctggggcacatcatcacggccaagtactggcagcaggtc
cgtgagaacggcctgcacatgagcgtgaccgatagcggctgggccaagttcggctggggc
aagatctacggccagtggctttcgggcgccgagatcttctgctacgacatgatgaagttc
attcccgccaagctgctgcagcacatgcaggattacgacctgaaaaccttctgcgcgcct
cccaccatgtaccgtttcatgctgcaggaggacgtggcgtcctacgacctgtccagcatc
gagaacttcgccacggcgggcgagcccctgaacgccgaggtctccatcaaatgggagcag
ctcacgggcaagaagatccgcgaaggcttcggccagagcgaaggcccggtgctcgtggcc
acgttcccgtggatcgagccgcgtcccggcgcgctgggcaaacccagcccgctgctgaac
atcaagctgctcgacgacgacggccgcgaggtggaggatggtgaagaaggagccatctgc
atcacccgtctgaaggaggcgtacccgccggggttgttcgtgggctatttcggcctgccc
gagcagaccgccgaaaccgtgggcggcgagtattacaacctgcacgacatggcatggcgc
gacgtcgagggctatatctcgttcgtcggccgcaacgacgacgtcatcaagtgctccggc
taccgcatcggtcccttcgaggttgaaagcgccctggtcaagcacgacgccgttgtcgag
tgcgcggttacggcggcgcccgacccgatccgcggcaaggtcgtgaaagccaccatcgtg
ctggctcgtggctacgagcccagccccgagctgaccaaggagctgcagaattgggtgaag
aaggagacggcgccgtacaagtatccccgcatcgtggagtacgtggacgagctgcccaag
actgtcggcggcaagatcaagcgcaagctcatccgccagcaggacggcatcaccgatgac
gataagatccattccatcggcagcgacaggagtgccgtggacgagtcctggaagtccaac
gagtcgtag

DBGET integrated database retrieval system