KEGG   Slackia heliotrinireducens: Shel_19960Help
Entry
Shel_19960        CDS       T00981                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00010  Glycolysis / Gluconeogenesis
shi00052  Galactose metabolism
shi00500  Starch and sucrose metabolism
shi00520  Amino sugar and nucleotide sugar metabolism
shi00521  Streptomycin biosynthesis
shi01100  Metabolic pathways
shi01110  Biosynthesis of secondary metabolites
shi01120  Microbial metabolism in diverse environments
shi01130  Biosynthesis of antibiotics
shi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shel_19960
   00052 Galactose metabolism
    Shel_19960
   00500 Starch and sucrose metabolism
    Shel_19960
   00520 Amino sugar and nucleotide sugar metabolism
    Shel_19960
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Shel_19960
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Shel_19960
Enzymes [BR:shi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Shel_19960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Acetate_kinase BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACV23010
UniProt: C7N7X5
Position
complement(2233881..2234858)
Genome map
AA seq 325 aa AA seqDB search
MTTHDSTDASAQVGPGRAQTGKLLVGIDMGGTTIKVGLVDESGALHARQTVPTGGLSDKD
SQHAFASMVRSIVGDKQGLIHGVGFAVPGPVDRDGNLRMGVNVDLDLPGMLQALQREFPS
AWVRALNDANAAAFGECNRGAAVGRKDVLLVTLGTGVGAGVVADGKVLVGARGIAGEIGH
MCVEASGVKCNCGRYGCLEQYSSARGLIRLMRESALQAGDERSASVEDARQVMEAFERSN
PHAVHAMEVFSDRLGYALANIACVIDPEVILLGGGVSECFDLFEDMLRASFDMYALGESR
SVEFRKAALGNEAGMVGAALFSIAQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcatgattcaactgatgcgtctgcccaggtaggcccagggcgcgcccaaacg
gggaagctgcttgtcggaatcgacatgggcggcacgaccatcaaggtgggccttgtggac
gaaagcggtgcgctgcatgcgcgacagaccgttcctacaggaggattaagcgacaaggac
tcccagcatgccttcgcctccatggtcagaagcattgtcggagacaagcaggggctcatc
cacggcgtggggttcgccgtgcctggccccgttgaccgggacggcaacctgcggatgggc
gtcaacgtcgatttggatctgccggggatgcttcaggcgctgcagcgcgagttcccttcg
gcgtgggtacgcgctttgaacgacgcaaacgccgcagcgtttggagaatgcaaccgcggt
gcggcggtaggtcgcaaggacgtgctactggtgacgctcggcaccggcgtcggggccggg
gttgtggcggacgggaaggtgctcgtgggcgcccgaggcatcgctggcgaaatcggccat
atgtgcgtcgaggccagcggcgtgaagtgcaactgcgggcggtacggctgtttggaacag
tactcttccgcacgtggccttatccgtctcatgcgcgagtctgccctgcaggccggcgac
gagcgttccgcttcggtcgaggacgcccgccaggtcatggaagcgttcgaacggtcgaac
ccgcatgccgtgcacgccatggaagtgttcagcgatcggctaggctatgcgctggccaac
atcgcatgcgtcatcgaccctgaggtcatcctactgggcggcggcgtgtcggagtgtttc
gatctgttcgaggacatgctgagggcatcattcgatatgtacgcccttggcgagagccgc
tctgtggaatttcgcaaggcggccctgggcaacgaggccggtatggtcggggcagcgttg
ttctcgatcgcccagtag

DBGET integrated database retrieval system