KEGG   Slackia heliotrinireducens: Shel_19960Help
Entry
Shel_19960        CDS       T00981                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
shi  Slackia heliotrinireducens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shel_19960
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shel_19960
   00052 Galactose metabolism
    Shel_19960
   00500 Starch and sucrose metabolism
    Shel_19960
   00520 Amino sugar and nucleotide sugar metabolism
    Shel_19960
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Shel_19960
   00524 Butirosin and neomycin biosynthesis
    Shel_19960
Enzymes [BR:shi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Shel_19960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2233881..2234858)
Genome map
AA seq 325 aa AA seqDB search
MTTHDSTDASAQVGPGRAQTGKLLVGIDMGGTTIKVGLVDESGALHARQTVPTGGLSDKD
SQHAFASMVRSIVGDKQGLIHGVGFAVPGPVDRDGNLRMGVNVDLDLPGMLQALQREFPS
AWVRALNDANAAAFGECNRGAAVGRKDVLLVTLGTGVGAGVVADGKVLVGARGIAGEIGH
MCVEASGVKCNCGRYGCLEQYSSARGLIRLMRESALQAGDERSASVEDARQVMEAFERSN
PHAVHAMEVFSDRLGYALANIACVIDPEVILLGGGVSECFDLFEDMLRASFDMYALGESR
SVEFRKAALGNEAGMVGAALFSIAQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcatgattcaactgatgcgtctgcccaggtaggcccagggcgcgcccaaacg
gggaagctgcttgtcggaatcgacatgggcggcacgaccatcaaggtgggccttgtggac
gaaagcggtgcgctgcatgcgcgacagaccgttcctacaggaggattaagcgacaaggac
tcccagcatgccttcgcctccatggtcagaagcattgtcggagacaagcaggggctcatc
cacggcgtggggttcgccgtgcctggccccgttgaccgggacggcaacctgcggatgggc
gtcaacgtcgatttggatctgccggggatgcttcaggcgctgcagcgcgagttcccttcg
gcgtgggtacgcgctttgaacgacgcaaacgccgcagcgtttggagaatgcaaccgcggt
gcggcggtaggtcgcaaggacgtgctactggtgacgctcggcaccggcgtcggggccggg
gttgtggcggacgggaaggtgctcgtgggcgcccgaggcatcgctggcgaaatcggccat
atgtgcgtcgaggccagcggcgtgaagtgcaactgcgggcggtacggctgtttggaacag
tactcttccgcacgtggccttatccgtctcatgcgcgagtctgccctgcaggccggcgac
gagcgttccgcttcggtcgaggacgcccgccaggtcatggaagcgttcgaacggtcgaac
ccgcatgccgtgcacgccatggaagtgttcagcgatcggctaggctatgcgctggccaac
atcgcatgcgtcatcgaccctgaggtcatcctactgggcggcggcgtgtcggagtgtttc
gatctgttcgaggacatgctgagggcatcattcgatatgtacgcccttggcgagagccgc
tctgtggaatttcgcaaggcggccctgggcaacgaggccggtatggtcggggcagcgttg
ttctcgatcgcccagtag

DBGET integrated database retrieval system