KEGG   Slackia heliotrinireducens: Shel_21570Help
Entry
Shel_21570        CDS       T00981                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shi  Slackia heliotrinireducens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Shel_21570
Enzymes [BR:shi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Shel_21570
Exosome [BR:shi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shel_21570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2392775..2394286)
Genome map
AA seq 503 aa AA seqDB search
MPKKYVMSLDQGTTSSRAILFDKQGVICGVAQHPFTQIYPQPGWVEHDPMEIASTQLGVM
AEALIAAGATPDEIDSIGITNQRETTVVWDRTTGEPVANAIVWQCRRTAGIIDELCSDPQ
VAADITAKTGLVPDAYFSASKIKWILDSVPGARQRAEAGELAFGTVDTWLIWQLTDGKVH
ATDRTNASRTMLFDIHKGDWDDDLLKLFGVPRAMLPEVLPSSADFGVTSRAGLPEGIPIR
GVAGDQQAALFGQCCFEPGQTKNTYGTGCFLLMNTGTEAVASKNGLVTTIAASAPGAEGI
EYALEGSVFVAGALIQWLRDELGIISDAAETEGLANSVENCAGVYVVPAFTGLGAPYWDA
QARGAILGLTRGAGRAHIARAALEALAYQAADVVRTMEADSGIPIKHLNVDGGACRNNFL
MQFQADILDAQINRPQVIESTAFGAALLAGLNTGFWKDLGAVRSLRETDDRFVSHMDEES
RKAHLDGWHDAVARVSTKLNKTL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaaagtacgtcatgtccctcgaccagggcaccacgtcgtcccgcgcgatcctc
ttcgacaaacagggtgtcatctgcggcgtcgctcagcatcccttcacgcagatctacccg
cagccgggctgggtcgagcacgacccgatggaaatcgcatccacgcaactgggtgtcatg
gccgaagccctgatcgccgccggcgccacgcccgacgagatagactccatcggcatcacc
aaccagcgcgagaccaccgtcgtgtgggaccgcaccacgggggagcccgtcgccaacgcc
atcgtatggcagtgccgccgcacggccggcatcatcgacgagctgtgctccgatccgcag
gtcgcagccgacatcacggcgaaaaccggcctcgtgcccgatgcgtacttctcggcaagc
aagatcaaatggatcctggacagcgtgcctggtgcccgtcagcgtgccgaagcgggcgag
ctggcgttcgggaccgtggacacgtggctcatctggcagctgaccgacggcaaggtgcat
gcgaccgaccgcaccaacgccagccgcaccatgctgttcgacatccataagggcgattgg
gacgacgatctgctgaaactgttcggcgtgccccgtgccatgctgcccgaggtgctgccg
tcgtcggcggatttcggggtcacatcccgcgcgggcctgcccgaaggcatccccatccgc
ggcgtggccggtgaccaacaggcggccctgttcggccagtgctgcttcgagccgggccag
accaagaacacctacggcaccgggtgcttcctcctgatgaacacgggaaccgaggccgtt
gcttctaaaaacggcctggtcaccaccattgcggcaagcgctccaggggccgagggcatc
gaatacgcccttgagggaagcgtgttcgtggcgggcgccctcatccagtggctccgcgac
gagctgggcatcatctccgatgcggccgaaacggaaggcctggccaacagcgtggagaac
tgcgccggcgtctatgtggtgccggcattcaccgggttgggcgccccctattgggatgcg
caggcccgcggtgcaatcctggggttgacccgtggcgccggtcgcgcccacatcgcccgc
gcggcgttggaggctttggcctatcaggcggcggacgtggtccgcaccatggaggccgac
tcgggcatccccatcaagcatctcaacgtggacggcggcgcgtgccgcaacaacttcctc
atgcagttccaggccgacatcctggacgcgcagatcaaccgtccgcaggtcatcgagagc
acggcgttcggtgcggcattgctggcgggcctgaacacggggttctggaaagacctcggc
gcggtccgttcgctgcgcgagacggacgaccggttcgtttcccatatggatgaggagagt
cgcaaagcccatcttgacggatggcacgatgcggtcgcccgtgtttcaacgaagttaaat
aagacgctttga

DBGET integrated database retrieval system