KEGG   Slackia heliotrinireducens: Shel_22490Help
Entry
Shel_22490        CDS       T00981                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
shi  Slackia heliotrinireducens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shi00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:shi00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2491218..2492456)
Genome map
AA seq 412 aa AA seqDB search
MSRRTFAAGLAGMASCAALGTLTGCSLFASDDEPKHRDKDSFDVDDSSSEAKGSGGEPME
KPAKTLDDEITEEIAGWNIEQKVAQLFFVRPESFTGMGQVTAAGDTSRTAYGTYPVGGIC
YFAENLVDPAQTTEMLTNMAQIGVDTIGHAPFLAVDEEGGTVTRIASNPAFGVTDVGDMA
AIGDTGDVSQAKSAAQAIAGYLKPLGFNMDFAPCCDIANVEGGVMAQRSFGSDPELVSDM
VEAQIEGFVESGMLCSAKHFPGIGAAIGDSHDGSISIGSTLEELQATELVPFQRAVQVGV
PFVMVGHLSVPNVTGDDTPASISKVMVTDVLRDQLQYDGIVVTDSLEMGAVTAYGDAGAV
MALQAGCDMVLMPLDFAAAYNAVLAAVSDGTLSEERIDESLTRILRVKMTME
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgccgcacgttcgcggcggggcttgctggcatggcgtcctgcgcggcgttggga
acgctgactggatgctcgctgttcgcctccgacgatgagccgaagcatcgcgacaaggac
tccttcgacgttgacgacagctcgtcggaggcgaagggttcgggcggcgagcccatggaa
aaacctgccaaaaccttggacgacgagattaccgaggagattgcaggctggaacatcgag
cagaaggtggcccagctgttcttcgtgcggcccgagtcgttcaccggaatgggccaggtc
acagcggcaggggataccagccgcaccgcctatggcacctatccggtaggcggcatctgc
tactttgcggagaacctggtcgaccctgcgcagaccaccgaaatgctcacgaacatggcc
cagatcggtgtggatacgatagggcatgcgccgtttctggcggttgacgaagagggcggc
accgtgacccgcatcgcctcgaaccccgccttcggcgtgacggacgtgggggacatggcc
gccatcggagataccggggatgtatcgcaggcgaaatcggcggcgcaggccatagccggc
tacctcaagccgctcggcttcaacatggacttcgcgccgtgctgcgacatcgccaacgtg
gaaggcggcgtcatggcgcagcgatccttcggatcggaccccgagcttgtctccgacatg
gtggaggcccagatagaaggcttcgtcgagtcgggtatgctgtgcagcgccaagcatttc
ccaggtatcggggccgccatcggcgacagccatgacggcagcatctccatcggcagcacc
cttgaggagctgcaggcaaccgagctcgttcccttccagcgcgccgttcaggtgggcgtg
cctttcgtcatggtggggcatctgtcggtgccgaacgtgacgggcgacgacacgccggcc
tccatttcgaaggtgatggtgaccgacgtcctgcgcgaccagctgcaatacgacggcatt
gtggtgacggattccttggagatgggcgccgttacggcctatggggatgcgggtgcggtc
atggcgttgcaggccggatgcgatatggtgctcatgccgctggacttcgcggcggcgtac
aatgcggtgttggcggcggtgtccgacggcacgttgagtgaagagaggattgacgagtct
ttgacccgcatcctgcgtgtcaagatgacgatggaatag

DBGET integrated database retrieval system