KEGG   Slackia heliotrinireducens: Shel_22490Help
Entry
Shel_22490        CDS       T00981                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
shi  Slackia heliotrinireducens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shel_22490
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Shel_22490
Enzymes [BR:shi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Shel_22490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2491218..2492456)
Genome map
AA seq 412 aa AA seqDB search
MSRRTFAAGLAGMASCAALGTLTGCSLFASDDEPKHRDKDSFDVDDSSSEAKGSGGEPME
KPAKTLDDEITEEIAGWNIEQKVAQLFFVRPESFTGMGQVTAAGDTSRTAYGTYPVGGIC
YFAENLVDPAQTTEMLTNMAQIGVDTIGHAPFLAVDEEGGTVTRIASNPAFGVTDVGDMA
AIGDTGDVSQAKSAAQAIAGYLKPLGFNMDFAPCCDIANVEGGVMAQRSFGSDPELVSDM
VEAQIEGFVESGMLCSAKHFPGIGAAIGDSHDGSISIGSTLEELQATELVPFQRAVQVGV
PFVMVGHLSVPNVTGDDTPASISKVMVTDVLRDQLQYDGIVVTDSLEMGAVTAYGDAGAV
MALQAGCDMVLMPLDFAAAYNAVLAAVSDGTLSEERIDESLTRILRVKMTME
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgccgcacgttcgcggcggggcttgctggcatggcgtcctgcgcggcgttggga
acgctgactggatgctcgctgttcgcctccgacgatgagccgaagcatcgcgacaaggac
tccttcgacgttgacgacagctcgtcggaggcgaagggttcgggcggcgagcccatggaa
aaacctgccaaaaccttggacgacgagattaccgaggagattgcaggctggaacatcgag
cagaaggtggcccagctgttcttcgtgcggcccgagtcgttcaccggaatgggccaggtc
acagcggcaggggataccagccgcaccgcctatggcacctatccggtaggcggcatctgc
tactttgcggagaacctggtcgaccctgcgcagaccaccgaaatgctcacgaacatggcc
cagatcggtgtggatacgatagggcatgcgccgtttctggcggttgacgaagagggcggc
accgtgacccgcatcgcctcgaaccccgccttcggcgtgacggacgtgggggacatggcc
gccatcggagataccggggatgtatcgcaggcgaaatcggcggcgcaggccatagccggc
tacctcaagccgctcggcttcaacatggacttcgcgccgtgctgcgacatcgccaacgtg
gaaggcggcgtcatggcgcagcgatccttcggatcggaccccgagcttgtctccgacatg
gtggaggcccagatagaaggcttcgtcgagtcgggtatgctgtgcagcgccaagcatttc
ccaggtatcggggccgccatcggcgacagccatgacggcagcatctccatcggcagcacc
cttgaggagctgcaggcaaccgagctcgttcccttccagcgcgccgttcaggtgggcgtg
cctttcgtcatggtggggcatctgtcggtgccgaacgtgacgggcgacgacacgccggcc
tccatttcgaaggtgatggtgaccgacgtcctgcgcgaccagctgcaatacgacggcatt
gtggtgacggattccttggagatgggcgccgttacggcctatggggatgcgggtgcggtc
atggcgttgcaggccggatgcgatatggtgctcatgccgctggacttcgcggcggcgtac
aatgcggtgttggcggcggtgtccgacggcacgttgagtgaagagaggattgacgagtct
ttgacccgcatcctgcgtgtcaagatgacgatggaatag

DBGET integrated database retrieval system