KEGG   Slackia heliotrinireducens: Shel_24640Help
Entry
Shel_24640        CDS       T00981                                 

Definition
phenylacetaldehyde:ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
shi  Slackia heliotrinireducens
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shel_24640
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shel_24640
Enzymes [BR:shi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Shel_24640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2730507..2732318
Genome map
AA seq 603 aa AA seqDB search
MTRGYGWIGTILRVNLTEGTIKKEPLNMQDANDYVGARGLGTKYYCNEVDPKIDPLSPEN
KLIFMTGPLTGTAACSAGRYEVVSKAPLTGIIGAANSGGHFGPELKYAGYDGIIFEGKAD
HPVYLHIDDELVELLDASDLWGQGVHPVTDALEAKHGKVRVATIGRPGERQMLYAAIMND
KNRAAGRGGMGAVMGSKNLKAVVVRGTGGVKVARPEKFMEEATKARTMLREHPVTGAGLA
GYGTEILVNIVNEVGGLPLRNARDGAFWDKADDTSGERLVETHLIKNQGCFGCTIACGRV
TKIEGKGDLDGFGEGPEYEAGWSYGAACGVNDISAIVKANFICNEEGMDPITLGSTVACA
MELFEMGAIPESDIGFPLRFGDAEAMVKLTQMCADGEGFGNVIGLGSYRLAEKYGHPELS
MSTKKQEMPAYDGRAIQGIGLEYATSNRGGCHVRGYMIAPEVLGIPVKMDPQVTEGKGAM
LKTFQDLTALCDSTGICLFTTFGIGLPEIAGQYREAVGSDETDEEILLKGERIWNLEKRF
NIEAGVEKDTLPPRLLREALPTGPAKGKVNELQTMLADYYAARNWTADGIPTQEKLDELS
LTY
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcggatacggatggatcggaacaatccttcgcgtcaacctgaccgaaggcacc
atcaaaaaagagccgctgaacatgcaggatgccaacgattacgtcggcgcccgcggcttg
ggaaccaagtactactgcaacgaggtcgatccgaaaatcgaccccctgtcgcctgagaac
aagctcatcttcatgaccggcccgctcaccggcacggccgcctgctccgccggccgttac
gaggtcgtctccaaggccccgctgaccggcatcatcggcgccgccaactccggcggccac
ttcggccccgagctgaagtacgccggctacgacggcatcatcttcgaaggcaaggccgac
catccggtctacctgcacatcgacgatgaactggtcgaactgctcgacgccagcgatctg
tggggccagggcgtgcacccggtcaccgatgcactggaggccaagcacggcaaggtccgc
gtggccaccatcggcaggccgggcgaacggcagatgctctatgcggccatcatgaacgac
aagaaccgcgccgccggccgtggcggcatgggtgccgtcatgggctccaagaacctgaag
gccgtcgtcgtgcgcggcacgggcggcgtgaaggtcgcccgccccgagaagttcatggag
gaagccactaaggcccgcaccatgcttcgcgaacatcccgtcaccggcgccggcctggca
ggctacggcacggaaatcctggtgaacatcgtcaacgaggtcggcggtctgccgctgcgc
aatgcccgcgacggtgccttctgggacaaggccgacgacacctccggcgagcgcctggtg
gaaacccacctgatcaagaaccagggctgcttcggctgcaccatcgcctgcggccgcgtg
accaagatcgaaggcaagggcgaccttgacggcttcggcgaaggccccgagtacgaagcc
ggttggtcctacggcgcagcctgcggcgtgaacgacatctcggccatcgtcaaggcgaac
ttcatctgcaacgaggaaggcatggaccccatcaccttgggctccaccgtcgcctgcgcc
atggagctcttcgaaatgggcgccatccccgagtccgacatcgggttcccgctgcgcttc
ggcgatgcggaagccatggtcaagctcacccagatgtgcgctgacggcgaaggcttcggc
aacgtcatcgggctgggctcctatcgtctggccgaaaaatacggccaccccgagctttcc
atgtccaccaagaagcaggaaatgccggcttacgacggccgtgccatccagggcatcggc
cttgagtacgccacttccaaccgcggcggctgccatgtgcgcggctacatgatcgccccc
gaggtgctgggcatccctgtgaagatggatccgcaggtcaccgaaggcaagggtgccatg
ctcaagaccttccaggacttgacggcgctctgcgactccacgggcatctgcctgttcacc
accttcggcatcggtctgccggaaattgccggccagtaccgcgaggccgtgggttcggac
gaaaccgacgaggagattctgctgaagggcgagcgcatctggaaccttgaaaagcgcttc
aacatcgaagccggcgtggagaaggacacgctgccgccgcgtctgctgcgcgaagcgctg
cccaccggtcccgcgaagggcaaggtcaacgagctccagaccatgctggccgactactat
gcggcacgcaactggacggctgacggcatccccacgcaggagaagctcgacgaactgagc
ctgacgtactag

DBGET integrated database retrieval system