KEGG   Slackia heliotrinireducens: Shel_25660Help
Entry
Shel_25660        CDS       T00981                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00220  Arginine biosynthesis
shi00250  Alanine, aspartate and glutamate metabolism
shi00471  D-Glutamine and D-glutamate metabolism
shi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shel_25660
   00220 Arginine biosynthesis
    Shel_25660
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Shel_25660
Enzymes [BR:shi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Shel_25660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACV23573
UniProt: C7N2R5
Position
2837731..2838732
Genome map
AA seq 333 aa AA seqDB search
MQQDDQELHTNAEMPDWRHDAHVLEEHLQHAYVLGCKVLGQGHVATYIPELARADAYAFG
LAAQRTDGTMVCCGDVDTRFSVQSVGKVMSLAMALKIFGTEEVFSHVLMEPSGDSFSSII
KLDTKSDLPFNPLINAGAIQVVSLLANHVEFSDILKFARRMCQDEDIELNEPVYRSEALT
GDRNRAIAYLLKSKGVLMAEPDLTLDLYFKLCSMNVTAKSLATLGLVLANDGQNPMTGEH
IISPRHARAINSIMFTCGMYDGSGEFGVKVGIPAKSGVGGGIACSVKGRMGIGVYGPALD
EKGNSVGGLASLEYLSHALHLHVFDYHPYIIDE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagacgaccaagaactgcacaccaacgccgaaatgcctgattggcgccacgat
gcacacgtgcttgaggagcacctgcaacacgcctacgtactgggatgcaaggtgctcgga
caaggccatgtggccacctacattcccgagctggcgcgcgccgacgcgtatgcgttcggt
ctggcggcgcaaaggacggacggcaccatggtctgctgcggcgacgtggacacgcggttc
tccgtccaaagcgtaggcaaggtcatgagcctggccatggccctgaagatcttcggcacc
gaagaggtgttctcgcacgtgctgatggagccttcgggcgactcgttcagttcgatcatc
aaactggacacgaaaagcgacctgccattcaacccgctgatcaacgcaggcgccatccag
gtggtaagcctgcttgccaaccacgtggagttttccgacatcctcaaattcgcacgccgt
atgtgccaggacgaggacatcgaactcaacgagcccgtctaccgctcggaggcgctcacg
ggcgaccgcaaccgcgccatcgcgtacctgctgaagagcaaaggcgtgctcatggccgag
ccagacctcacgctggacctgtacttcaagctgtgctcgatgaacgtgaccgcgaagtcg
ctggccacgctggggttggtgctggccaacgacgggcagaaccccatgaccggcgagcac
atcatttcgccacgtcacgcgcgggccatcaacagcatcatgttcacctgcggcatgtac
gacgggtccggcgagttcggcgtgaaggtgggcatccccgccaaaagcggcgtgggcggc
ggcatcgcctgcagcgtgaaggggcgcatgggcatcggcgtgtacggcccggcgctggac
gagaagggcaacagcgtgggcggcctggcatcgctggaatacctgtcgcacgccctgcac
ctgcacgtgttcgactaccatccctacatcatcgacgagtag

DBGET integrated database retrieval system