KEGG   Shewanella halifaxensis: Shal_0444Help
Entry
Shal_0444         CDS       T00654                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shl  Shewanella halifaxensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Shal_0444
Enzymes [BR:shl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Shal_0444
Exosome [BR:shl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shal_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
521778..523259
Genome map
AA seq 493 aa AA seqDB search
MSKKYIIALDQGTTSSRAIVFDHSTNMVASCQREFSQMYPKPGWVEHDAMEIWASQSSTL
IEALARADIHSEDVAAIGITNQRETTVIWDKATGKPVYNAIVWQCRRSKAICDELKTQGL
EDYVKQATGLLLDPYFSGTKIKWILDNVDGVRERAEKGELLFGTIDTWLVWKLTEGQAHV
TDPTNASRTMLFNIHTQEWDETLLKALNIPRSILPEVKPSSAVYGHTRIVGEGSHIAIAG
MAGDQQAALFGQLCIEEGMAKNTYGTGCFLLMNTGTEAVQSQHGLLTTIAIGANGEVNYA
LEGSVFMGGATVQWLRDELGLIRDAQDTEYFASKVEDTHGVYLIPAFVGLGAPYWDPDAR
GALVGLTRGANRNHIIRAALEAIAYQSRDLLDAMAKDSRVELKQIKVDGGAVANDFLMQF
QSDITNVEVQRPDLTETTAMGAAFLAGLAVGFWDSTDELKLKAGVERSFTPQITAQKRDS
LYQGWQNAVARTR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaagaaatacatcattgcactggaccaaggtacaaccagttctcgagccatagtg
tttgatcacagtactaatatggtcgctagttgtcagcgtgagtttagccagatgtaccct
aaaccgggctgggttgaacatgatgcaatggagatttgggcttcgcaaagctcgactctc
attgaggcattagcccgagccgacattcatagtgaagatgttgccgccatcggtattact
aaccagcgtgaaaccacggtgatatgggataaggccacaggcaagcccgtttacaatgca
atcgtgtggcagtgccgtcgtagtaaagctatctgtgatgagctaaaaacacaggggctt
gaagattatgtaaagcaagcaacaggtttactactcgacccctatttctctggcaccaaa
attaagtggattttagataatgtcgatggggtaagagagcgtgctgaaaaaggtgagtta
ctgtttggcaccattgatacctggttggtatggaagctaaccgaggggcaagcccatgtt
accgatccgactaatgcatcacgtaccatgttatttaatatccacacccaagagtgggat
gagactctgcttaaggcgctcaatattccgcgctcaatattacctgaggtaaaaccttca
tcggcggtttatggtcatacccgtatcgtgggtgaaggtagccatattgctattgcgggt
atggcgggcgatcagcaggcggcgctatttggtcagctttgcattgaagagggcatggcc
aaaaatacgtacggtaccgggtgtttcctgttgatgaacactggtactgaagccgttcag
tcacaacatgggttattaaccaccatcgcaattggggctaatggcgaagtgaattacgcg
ctagaaggctcggtatttatgggcggtgctacggtgcagtggcttagagatgagcttggg
cttattcgtgatgcgcaagataccgagtactttgcctctaaggttgaagatactcacggg
gtatatttaattcctgcatttgttggcttgggcgcaccatattgggatccggacgcaaga
ggagccttagtggggttaactcgaggcgctaatcgtaaccatatcatcagggccgcactt
gaggcgatcgcctatcaaagtcgtgatttgctcgatgccatggctaaagatagtcgtgtt
gaacttaagcagattaaggtcgatggcggtgcggtggcgaatgatttcttgatgcagttt
cagtcagatattaccaatgtcgaagttcagcgaccagatttgactgaaaccacggccatg
ggcgcagcatttttagctgggttggcggtcgggttttgggattcaacggatgaactaaag
cttaaggccggagtggagcgcagctttacgccgcagataacggcacaaaagcgcgatagt
ttataccaaggttggcaaaatgcggtggctcggactcgataa

DBGET integrated database retrieval system