KEGG   Shewanella halifaxensis: Shal_0477Help
Entry
Shal_0477         CDS       T00654                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shl  Shewanella halifaxensis
Pathway
shl00010  Glycolysis / Gluconeogenesis
shl00020  Citrate cycle (TCA cycle)
shl00620  Pyruvate metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
shl01200  Carbon metabolism
Module
shl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shal_0477
   00020 Citrate cycle (TCA cycle)
    Shal_0477
   00620 Pyruvate metabolism
    Shal_0477
Enzymes [BR:shl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Shal_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_D23 HlyD_3 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ABZ75052
JGI: Shal0477
UniProt: B0TQQ9
Position
566248..567915
Genome map
AA seq 555 aa AA seqDB search
MAELKEVLIPDIGGDEVQVIEICAAVGDTLAAEESIITVESDKATMDIPAPFAGVLSELK
VAVGDTVSEGTLIAMMSAAGAQAPTEVESTPAAPDAVQAPVAAQAPAPEEAPAASVASTT
QVIEVSVPDIGDASDVDVIEVLVAVGDKIDADTGLITLETDKATMEVPAPSAGIVKELKV
AVGDKVSMGSLVLMLEVSDAAPAAPVVAAPATSTPAPVAPAPVAQAASANKPPVPHHPSA
GSQPKTGAVHASPAVRRLAREFGADLTLVKGTGRKGRILKEDVQAFIKYELSRPKASAAT
AVAGGAGGLSVIAAPKVDFAKFGEVEEVPLSRIQKISGPNLHRNWVTIPHVTQFDEADIT
ELEAFRKDQNAVAAKKKADYKITPLVFMMKAVAKTLAEFPVFNSSLSADGESLIQKKYFH
IGVAVDTPNGLMVPVVRDVDKKGIVELSRELTEISVKARDGKLKAADMQGSCFTISSLGG
IGGTAFTPIVNYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFS
VTLSSILSDIRTLIL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagttttgattcctgatatcggtggcgatgaagttcaggttatt
gagatctgtgctgcggtcggcgacacgcttgccgctgaagagtcaattatcacggttgaa
agtgataaggcgacgatggatatccctgcaccttttgctggcgtattgagcgaacttaaa
gttgcggtaggtgatacggtttcagaaggtacacttatcgccatgatgtctgcagcgggg
gcacaagctcctactgaggtagagtctacaccagctgcccctgacgccgttcaggctcct
gttgccgctcaggctccagcaccagaagaagcgccagcggcttcggttgcaagcacaact
caggtgattgaagttagcgtgccagatattggtgatgcaagtgatgtcgatgtgattgaa
gtcttagttgccgtgggcgacaagattgatgccgatactggcttaattactcttgagaca
gataaagcgaccatggaggtgccagcaccttcggcgggtatcgttaaagaacttaaagtt
gccgttggcgacaaggtatcgatgggttcactggtattgatgcttgaagttagcgatgct
gctcctgcagcaccggttgtggcagctcctgcaacaagcactccagctcctgttgcgcca
gcacccgttgctcaagcggcctcggcaaacaagccgcctgtgccgcatcatccaagtgcg
ggcagtcagcctaaaaccggtgccgtacatgcttcacctgcagtacgtcgtttagcacgt
gagtttggtgcagatcttactttggtaaaaggtacgggtcgtaaaggacgtattcttaag
gaagacgtacaggcatttatcaagtatgagctcagtcgtcctaaagcctctgctgcaaca
gccgttgcaggtggcgcaggtggattgagtgtgattgctgcaccaaaagtcgattttgct
aagtttggtgaagttgaagaagtgccactcagtcgtattcagaagatctctggtccaaac
ttacatcgcaactgggtaaccatcccacatgtgacgcagtttgatgaagctgatatcact
gagcttgaagcattccgcaaggatcaaaatgccgtcgctgcaaagaagaaagcggattat
aagatcacgcctttagtctttatgatgaaagcggtggctaaaaccttggctgaattccca
gtgtttaattcaagcttgagtgccgatggtgaatcactcatccagaagaaatacttccat
attggtgttgcggttgatacgccaaatggattgatggtgccagtggtacgtgatgtcgat
aagaaaggcatcgtagagctatcacgtgagttaacggagatctctgttaaggcgcgtgac
ggcaagctgaaagcggctgatatgcagggtagctgttttactatttcaagtcttggtggt
attggcggcacggcgtttacgccaatcgttaactaccctgacgttgccatcttgggggtg
tctaagtctgagattaagcctaagtggaatggtaaagagttcgagcctaagttgatgttg
ccgttgtcgttgtcatacgatcaccgtgtgattgatggcgcgatggctgcacgattcagt
gtcacgctttccagcattctaagtgatattcgcacacttattttgtaa

DBGET integrated database retrieval system