KEGG   Shewanella halifaxensis: Shal_0582Help
Entry
Shal_0582         CDS       T00654                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
shl  Shewanella halifaxensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shal_0582
Enzymes [BR:shl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Shal_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
698769..699686
Genome map
AA seq 305 aa AA seqDB search
MSQLIVLGSVNADHVLQVASFPRPGETLHGYNYQIIPGGKGANQAVAAARLGADTGFIAC
VGDDGFGRNIRHTFEQDGMEVSAVHMVENTPTGIAMIQVADSGENSICIAAAANDALTTK
VVEQHALKIEQAQYLLMQLETPLPGIELAASIAKAQGTQVILNPAPARSLPDTLLAMVDI
ITPNETEAELLTGVAITDADSAAQAAKVLHDKGIVTVMITLGSKGVYLSEQGEGKIIAGF
KVQVTDTTAAGDTFNGAFVTALLEGQTIDKAIVFAHAAAAISVTRFGAQTSIPTREEVEQ
FLAAH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagttaatcgttttaggcagtgtgaatgccgaccatgtactgcaagttgcctct
ttcccgcgtccgggagaaaccttgcatggttacaattaccaaattatcccaggtggtaaa
ggggctaatcaggccgttgctgctgcgcgcctaggtgctgatactggctttatcgcttgt
gtgggagacgatggttttggtagaaacatccgtcatacctttgagcaagatggtatggag
gtgtcggctgtacatatggtggaaaataccccaacgggcattgcgatgatccaagtggcc
gatagtggtgaaaacagtatctgtattgctgccgccgctaatgatgcattaacgacaaag
gttgttgagcagcacgccttgaaaatcgagcaagcacagtacttgctgatgcagttagaa
acgccactgccgggtattgagcttgccgctagcattgctaaagcccaaggaactcaggtg
atattgaatccagcgcctgcacgtagtctgcctgatactttactggcgatggttgatatc
attactcctaacgagacagaagctgagctattaactggagtcgcgattacagacgccgat
agcgccgctcaagctgcgaaagtactgcacgataaaggcatcgttactgtgatgatcacc
ttaggttcaaaaggcgtgtatttaagtgagcaaggtgaaggtaaaattattgcgggcttt
aaagtacaagtgaccgatactaccgctgccggtgatacttttaatggtgcctttgttacg
gcactgctcgaaggccagacaatagataaagcgattgtgtttgcccatgctgcggcggcg
atctcagtgacccgttttggcgcacaaacttctattccaacacgggaagaagttgagcag
ttcttagctgcgcactaa

DBGET integrated database retrieval system