KEGG   Shewanella halifaxensis: Shal_0861Help
Entry
Shal_0861         CDS       T00654                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
shl  Shewanella halifaxensis
Brite
Enzymes [BR:shl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Shal_0861
Secretion system [BR:shl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Shal_0861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1073700..1074428
Genome map
AA seq 242 aa AA seqDB search
MKFTRTFSLIAAMMIAPAAFAASSSTGDDTEALKQKLSDALSVEVISIKPSPISELYEAF
TDRGVLYITKDGSKLFHGNLYDLDKGMKNLTEAAMSGPRVDMMKPLEDSMLVYKAKNEKH
VVTIFTDVSCGYCRKLHNEMQEYNDLGITVRYLAFPRAGVPSANADEMESVWCAADPLKA
MGAAKNGKAVKQASCDAKIKEQYELGQAFGINGTPAIILEDGTLIPGYQPPKALLRTLES
VQ
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcactcgaacattttctctgattgctgcaatgatgattgcaccagcagctttc
gcagcgtcaagcagtacaggcgacgatactgaagcgttaaagcaaaaactaagtgacgcg
ctaagcgttgaagtgatctctattaagccgtcacctatttcagagctttatgaagccttt
actgatcgtggtgtgctttacattactaaagatggttcaaaactgtttcacggtaatctt
tatgatcttgataagggcatgaagaacctaaccgaagccgcaatgtcaggccctcgtgtg
gatatgatgaagccacttgaagacagcatgttggtttacaaagccaaaaacgaaaagcat
gtcgtgaccatttttaccgatgtcagctgcggatattgccgtaagttacataacgagatg
caagagtacaacgacctagggattaccgtgcgttacctagcgttcccacgtgcaggggtt
ccatctgccaatgccgatgagatggagtcagtatggtgcgccgccgacccattaaaagcc
atgggcgcagctaaaaatggcaaagcggttaaacaagcttcatgtgatgcaaaaatcaaa
gagcagtatgagttaggccaagcatttggtattaacggtacgccagcgattattcttgaa
gacggtaccctcattcctggttaccagcctcctaaggcactgctacgtactttagagtcg
gtacagtaa

DBGET integrated database retrieval system