KEGG   Shewanella halifaxensis: Shal_1012Help
Entry
Shal_1012         CDS       T00654                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
shl  Shewanella halifaxensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shal_1012
Enzymes [BR:shl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Shal_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1242698..1243189
Genome map
AA seq 163 aa AA seqDB search
MAKIFISLGSNIEPERYLKAALTDLDYYFETLELSSVFESEAVGFEGTNFLNMVVAAQTE
LPIADVVNRFKQIEQSHGRVKGAKKFAPRTLDLDLLLYDDTVSTQPIELPRAEILYNAFV
LWPLAEIAPSLTHPVVKQSYQTLWDSYDKSQQSLWPVEFSWSK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatttttataagccttggcagtaatattgaaccagaacgttaccttaaggcc
gcgctaactgatcttgattactattttgaaactctcgaactgtcatcggtatttgaaagt
gaagctgtgggttttgaaggcactaattttctcaatatggtggttgcagcccaaactgaa
ctaccgatagctgacgtggttaacaggtttaaacagattgaacaaagccacggccgagtg
aaaggtgccaagaagtttgccccaagaaccttagatttagatctgttgttgtatgacgat
acagttagtactcagccaatagagcttcctagagcggagatcctttataatgcctttgtt
ttatggccattagctgaaatcgccccctctttaacccaccctgttgtcaaacagtcgtat
caaaccctttgggatagctacgacaagagtcagcaatcattatggccagttgaatttagc
tggtctaagtaa

DBGET integrated database retrieval system