KEGG   Shewanella halifaxensis: Shal_1116Help
Entry
Shal_1116         CDS       T00654                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
shl  Shewanella halifaxensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shal_1116
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shal_1116
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shal_1116
Enzymes [BR:shl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shal_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1356114..1357400
Genome map
AA seq 428 aa AA seqDB search
MELYNLKHPSQVVSFTEAVKLGLGKDRGLFFPKQIPQLQDVDSLLALPFVERSKKVIGAW
LASELGQDTVDRLVERAFNFELPLVKADSNLYSLELFHGPTLAFKDFGARFMAQCLNELA
KSEKINILTATSGDTGAAVADAFYGLDNINVVVLYPKGKISVLQEKMFTTLGNNIHTVAV
ESDFDACQTLVKQSFEDLDIREGLHLNSANSINISRLLAQICYYFEAVAQFKQHNESDPV
IAVPSGNFGNLTAGLFAKAMGLPIKRFIAATNSNDTVPRYLDSGKWQPETTVATMSNAMD
VAEPSNWPRVEAIVEVMDWSLEDIVGLGITETQTAASVQALNSAGYLSEPHAAIAALALK
QTMSADEKGIFLATAHPAKFNEVVEEILNIELALPEPLARVVPKAIWSAELPADFALLKQ
HLFKVLLD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggagttatataacctaaagcacccgtcacaggtggtgagctttactgaagcggtcaag
ttaggccttggaaaggacagaggtctatttttcccaaaacagatcccacagttgcaagat
gtcgatagcttattggcgctgccatttgtagagagaagtaagaaagtcattggtgcttgg
ttggcctctgagcttggccaagatactgttgatagattggtagagcgtgcctttaacttt
gagctgccattagtgaaggctgatagcaatctgtatagtttggagttgtttcatggtcca
acgcttgcgtttaaagattttggcgcccgctttatggcccagtgtttaaatgaactagct
aaatcagaaaagattaacattctcacagccacctctggcgacactggggctgcggtagca
gatgcattctatggcttagataatattaatgtggtggtgctgtatccaaaaggcaaaatc
agcgtactacaggagaagatgtttaccacattaggaaacaatatccatacggttgcggta
gagtcagactttgatgcgtgccaaactttggtaaagcaatcatttgaagatctcgatatt
agggagggtttgcatcttaactcggcaaactcaattaatatcagccgtttgcttgctcaa
atttgctattacttcgaagcggttgcacagtttaagcaacataatgaaagcgatcccgtg
attgccgtacccagtggtaactttggtaacctaacggctggcttatttgctaaagccatg
gggctacctatcaagcgatttattgctgccacaaacagtaatgataccgtacctcgctat
ttagatagtggcaaatggcagccagaaaccaccgtcgcgacgatgtccaatgcgatggat
gtggccgagccgagtaactggccacgtgtcgaagcgattgtagaggttatggattggtct
ttggaggatattgttggcttggggatcactgagacgcaaacagcggcttcggtgcaagcg
ctgaatagcgctgggtacctttcagagcctcacgctgccattgctgctttggcacttaag
caaactatgtctgcagatgagaagggaatattcttagcaacggctcatccggctaaattt
aatgaggttgtggaagagatcctcaatattgagctagccttacctgagccattagctcgt
gtcgtcccgaaagctatttggtctgcagagttaccagcagattttgcgctgttaaaacaa
catcttttcaaggtgttgctagattaa

DBGET integrated database retrieval system