KEGG   Shewanella halifaxensis: Shal_1116Help
Entry
Shal_1116         CDS       T00654                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
shl  Shewanella halifaxensis
Pathway
shl00260  Glycine, serine and threonine metabolism
shl00750  Vitamin B6 metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01230  Biosynthesis of amino acids
Module
shl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shal_1116
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shal_1116
Enzymes [BR:shl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shal_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Galanin
Motif
Other DBs
NCBI-ProteinID: ABZ75685
JGI: Shal1116
UniProt: B0TJ94
Position
1356114..1357400
Genome map
AA seq 428 aa AA seqDB search
MELYNLKHPSQVVSFTEAVKLGLGKDRGLFFPKQIPQLQDVDSLLALPFVERSKKVIGAW
LASELGQDTVDRLVERAFNFELPLVKADSNLYSLELFHGPTLAFKDFGARFMAQCLNELA
KSEKINILTATSGDTGAAVADAFYGLDNINVVVLYPKGKISVLQEKMFTTLGNNIHTVAV
ESDFDACQTLVKQSFEDLDIREGLHLNSANSINISRLLAQICYYFEAVAQFKQHNESDPV
IAVPSGNFGNLTAGLFAKAMGLPIKRFIAATNSNDTVPRYLDSGKWQPETTVATMSNAMD
VAEPSNWPRVEAIVEVMDWSLEDIVGLGITETQTAASVQALNSAGYLSEPHAAIAALALK
QTMSADEKGIFLATAHPAKFNEVVEEILNIELALPEPLARVVPKAIWSAELPADFALLKQ
HLFKVLLD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggagttatataacctaaagcacccgtcacaggtggtgagctttactgaagcggtcaag
ttaggccttggaaaggacagaggtctatttttcccaaaacagatcccacagttgcaagat
gtcgatagcttattggcgctgccatttgtagagagaagtaagaaagtcattggtgcttgg
ttggcctctgagcttggccaagatactgttgatagattggtagagcgtgcctttaacttt
gagctgccattagtgaaggctgatagcaatctgtatagtttggagttgtttcatggtcca
acgcttgcgtttaaagattttggcgcccgctttatggcccagtgtttaaatgaactagct
aaatcagaaaagattaacattctcacagccacctctggcgacactggggctgcggtagca
gatgcattctatggcttagataatattaatgtggtggtgctgtatccaaaaggcaaaatc
agcgtactacaggagaagatgtttaccacattaggaaacaatatccatacggttgcggta
gagtcagactttgatgcgtgccaaactttggtaaagcaatcatttgaagatctcgatatt
agggagggtttgcatcttaactcggcaaactcaattaatatcagccgtttgcttgctcaa
atttgctattacttcgaagcggttgcacagtttaagcaacataatgaaagcgatcccgtg
attgccgtacccagtggtaactttggtaacctaacggctggcttatttgctaaagccatg
gggctacctatcaagcgatttattgctgccacaaacagtaatgataccgtacctcgctat
ttagatagtggcaaatggcagccagaaaccaccgtcgcgacgatgtccaatgcgatggat
gtggccgagccgagtaactggccacgtgtcgaagcgattgtagaggttatggattggtct
ttggaggatattgttggcttggggatcactgagacgcaaacagcggcttcggtgcaagcg
ctgaatagcgctgggtacctttcagagcctcacgctgccattgctgctttggcacttaag
caaactatgtctgcagatgagaagggaatattcttagcaacggctcatccggctaaattt
aatgaggttgtggaagagatcctcaatattgagctagccttacctgagccattagctcgt
gtcgtcccgaaagctatttggtctgcagagttaccagcagattttgcgctgttaaaacaa
catcttttcaaggtgttgctagattaa

DBGET integrated database retrieval system