KEGG   Shewanella halifaxensis: Shal_1124Help
Entry
Shal_1124         CDS       T00654                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
shl  Shewanella halifaxensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shal_1124
Enzymes [BR:shl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Shal_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1364332..1366698)
Genome map
AA seq 788 aa AA seqDB search
MAHQQEIVALKKFVRATNFLATSQIYLKKNVLHKRALEHSDIKPRLLGHWGTCPGINFVY
ANVNRLITKHNRSFVYLVGPGHGFPAVQANLFMEGSLSHFYPDTIPYNEDGITDICQKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVAWGAVLDNPDLIAACLIGDGESETGPLAASW
YANRLVSAKNNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYHPIIVDDQLEED
VYLQMAAAMDKSYEMINDIQTRARAGEDIVKPRWPVILMRTAKGWTGTAEFDGKKLEGNC
ESHQVIVNKCASNKGHLDALNTWLASYKFNELYSINEKGELIFDEDIQSLLPPKELTCGR
QHLSYGGEVVRALAKPDLEKLAYGPETPRGHRGLSMYKMGEWMRDAFKLNRDQRNLRIFC
PDETYSNQLQAVFEETSRAWQWPIESWDEDMSRDGRVIELLSENLLFGMLHGYTVTGRHA
MFPTYEAFSQVVSSMADQYCKYVYASQGVHFRKPVPACNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADGNSTLVYTERAYADRDKLNILVAGKKDLPQWLTLDEARQQ
AKDGVMVWDFASDENPDVVLVGCGDYVTQEAMAALVLIRELLPRVRIRFVSVTELTSSGL
GSLEFQAKPWLMDEVFTADKGVVFNYHGYPNTIKKLVFDYKGSKRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQSSVIDESQHVAITTDMLQRLVDHRNYIKANGVDPES
IENWVWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcagcaagaaattgtcgcacttaagaaatttgttcgagcaactaactttctg
gcgacatcacaaatttatttaaagaaaaacgtgctgcataaacgcgcacttgaacactcc
gatattaagcctaggctacttggtcactggggaacgtgcccaggtatcaattttgtctac
gctaacgttaacaggctcatcaccaagcacaaccgctcattcgtttatttagttggcccc
ggccatggctttccagctgttcaagcaaacttgtttatggaaggctccttaagccacttc
taccccgataccattccatataatgaagacgggatcaccgatatctgccagaagttctct
gccgcttatggttacccttcgcatgcgaaccctgaagcgccaggccaaatccttgaaggt
ggtgaactaggctattcactttctgttgcttggggcgctgttttagataatccagatctg
attgccgcttgccttatcggtgacggtgagtcagaaaccggcccactagctgcctcttgg
tatgcgaaccgtttagtgtctgcaaagaataatggtgctgttttacctattgttcatatc
aacggttataagatttcgggtccgactcgtatgggtcgtatgagccatgaagaactcgat
cttgaatttagaggtctaggttaccatcccattattgttgatgatcaattagaagaagac
gtttatcttcagatggctgccgcaatggataagtcatacgaaatgatcaatgacatccaa
acccgcgctcgtgcaggtgaagatatcgttaagccacgctggccagtgatcttaatgcgt
accgctaaaggctggacgggtactgccgagtttgatggtaagaaattagaaggtaactgt
gaatcccaccaggttatcgtcaacaaatgtgctagcaacaaaggtcacctcgatgcacta
aatacttggcttgcgagctacaagtttaatgagctttatagtatcaatgaaaaaggcgag
ctgatcttcgacgaagatattcagtcccttctaccaccaaaagaactaacctgtggtcgc
cagcatttaagttatggtggtgaagtggttcgcgcactcgctaaacctgatctagaaaag
cttgcctatggtcctgaaacccctcgcggccatcgcggcttatctatgtataagatgggc
gaatggatgcgtgatgcatttaagcttaaccgcgatcagcgtaacttacgtattttctgt
ccagatgaaacctattcaaatcaactacaagccgtatttgaagagacgagccgtgcatgg
cagtggcctatcgaaagctgggatgaagatatgtctcgtgacggtcgagtcatcgagttg
ctatcagaaaacctattattcggtatgttacacggctacacagtaacgggtcgccatgcc
atgttcccaacttatgaggcgttctcacaagttgtttcttcaatggccgaccaatactgt
aaatatgtatatgcgagccaaggcgtacatttccgtaagcctgttcctgcttgtaacgta
gttttatcctcactacttgagcgccaagatcacaacggttattcacatcaaaacccctct
ttcttgggtgcgatgcttgagaaacacccgaagattatctcagcttaccttcctgcagat
ggtaacagcaccttagtttatactgagcgcgcttatgccgatcgcgacaagctcaacatc
ttagtggcgggtaagaaagatctaccacagtggctaacactcgatgaggctcgtcaacaa
gcaaaagatggtgtcatggtttgggatttcgcatcagatgaaaacccagatgtggtactt
gtcggttgtggtgattatgtcactcaagaggcgatggctgcactggtgcttattcgtgag
ctgctaccacgtgtacgcattcgctttgtcagtgttacagaactcacaagtagtggttta
ggtagcttagagttccaagctaagccttggttgatggatgaagtattcacggcagataaa
ggtgtagtattcaattatcacggttatccaaacacgattaagaaactagtgtttgattat
aaaggtagcaagcgcttcagaattaaaggctatgaagaggaaggctcaacaacaactcca
tttgatatgggcgttcgtaatggcacatcacgttaccatctagtcattgatatggcatac
aagctcttccagagcagcgtgattgacgagtctcaacacgtggctatcaccaccgacatg
ctgcaacgcttagtcgaccatagaaattacatcaaggccaacggtgttgatcctgaaagc
atcgaaaactgggtttggacacgttaa

DBGET integrated database retrieval system