KEGG   Shewanella halifaxensis: Shal_1148Help
Entry
Shal_1148         CDS       T00654                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
shl  Shewanella halifaxensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shl00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:shl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1394433..1397138
Genome map
AA seq 901 aa AA seqDB search
MKIKVIVSAVALALSVGACSKQNESEETASVISPTEQSTLVSQPVNGSDFTQASLNQIGE
TLDISYRVVTNVPDGHCDQNTVDGRCFLAEIDLTSQVDIDNKDWAIYYSQMRPIQSIVGD
EFTITRIQGDLHKIAPAAGFSGIKKGQTKTIQFRGELWQLSETDAMPNYYIVADDLEPVI
IGSTQVAVDSETGMEVRPYVSAFTDSDTQYKRRETDKLEWATTEVLYRNNLNTPVDASLA
ENTILPTPSKVSLKIDAKPVSLKDGLKLELNDVSLEAVDAALQRLARIGVGQSDAEIGRG
ISTALLPLTAPSAKGEYRLDISSNGIKVFAADDAGFSYGLASLAALVDVDTLTVNPLLVE
DAPRYDFRGMHIDVSRNFHSKQLVLDLLDQMAAYKLNKLHLHMADDEGWRLEIADLPELT
EVGSKRCHDLNEDTCLLPQLGSGPFSNTKVNGYYSKADYIEILQYAAARQIQVIPSMDMP
GHSRAAIKSMEARYRKLMAQDKAAEANEYLLSDSQDKTVYSSIQYYNDNTLNVCMESTFT
FIDKVIDEIAKMHQQAGVPLNLYHIGADETAGAWLESPVCKAFIANNDKGVTNMQDLGAY
FIERTSKLLAAKGIEAAGWSDGMSHTRPENMPKQVQSNIWDVVAHGGHKRAHTQANLNWQ
AVLGQPEVLYFDFPYEADPKEHGYYWASRNTNSQKIHSFMAGNLPANAEQWTDIEALPFE
ADDMLKKDEAGKIISGPLKASIRFAGIQGQLWSETVRSDDVAEYMMFPRLMMLAERAWHK
PEWEVPYQYQGAVYNQQSGYFTKEMRQAQAKDWHRVANTLGAKELLKLDKAGIAYRVPTP
GAVINDGKLFANVIFPGLSIEYRDAKGQWQAYSDGVTVTAPVEVRVIAADGKRKGRILVV
N
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaaagtgatagtttcagcggtagcactcgcgttgtctgttggtgcttgttct
aagcagaatgaatctgaagagactgctagcgttatctcccccactgagcaaagcacactt
gttagtcagcctgtaaacggctctgactttactcaagcttcattgaaccaaattggcgag
acgctcgatattagctatcgcgtggtgactaacgttcccgatggccattgtgaccaaaat
acggtagatggccgctgtttcttggctgaaatagacctgacttctcaagtcgatatagac
aataaagattgggctatctactactcgcaaatgcgcccaattcaaagcatcgtgggtgat
gagttcactatcactcgtattcaaggcgatctacacaaaatagctccggcagcgggcttt
agtggtattaaaaagggccaaactaaaacgattcaatttcgcggtgagctgtggcagtta
tctgaaacagatgccatgcctaactactatatcgttgccgatgatctagaacccgtcatc
attggcagtactcaggtagcagttgactcggaaactggcatggaagtacgcccctatgtc
agtgcttttaccgacagcgatacccaatataaacgccgtgaaaccgataagcttgagtgg
gcaactactgaggtattatatcgtaataatctcaacacgcctgtagatgccagcttagca
gagaatacgattttaccaacaccatcaaaggtttcattgaaaatagatgcgaaacctgta
tcactaaaagatgggctaaagcttgagcttaatgatgtcagtctagaggccgttgatgcc
gcgctgcagcgtttagcacgtattggtgttgggcaaagtgatgctgagattggtcgtgga
attagcactgcactattacccttaaccgctcctagcgcaaagggcgagtatcgtcttgat
atctcaagcaatgggattaaagtttttgccgcagatgatgcgggcttctcctatggttta
gcctcactggcagcattggttgatgttgatacattaaccgttaatccgctgctggtggaa
gatgcgccgcgctatgattttcgaggaatgcatatcgatgtatcgcgcaacttccatagc
aagcagctagttttagatctattagatcagatggcggcctataagctcaataagttacat
ctgcatatggcggatgatgaaggttggcgtttagagatagcagacttacctgagctaaca
gaagtcggtagcaagcgctgtcatgatcttaatgaagatacctgtctactacctcagtta
ggaagtggtccctttagcaatactaaggtcaatggttactatagcaaagccgattatatc
gagatcttacagtatgcggcagcgagacaaatacaggtgatcccatcgatggatatgccg
gggcattcccgcgcggcaatcaagtcgatggaagcgaggtatcgtaagctaatggcgcag
gataaagctgcagaagcaaatgaatacctgttatcagatagccaagataaaacggtttat
tcatcgattcagtactataacgataacaccttgaatgtgtgtatggagtcgacctttacc
tttatcgataaggttatcgatgaaattgctaagatgcaccaacaagcgggtgtgccgctt
aatctttatcatatcggcgccgatgaaaccgctggggcttggttagagtcgcctgtatgt
aaggcctttatcgccaataacgataaaggcgtgacaaatatgcaagatcttggcgcctac
tttatcgagagaacgtctaagttattagcggccaaaggtattgaagcggcagggtggagc
gatggcatgagccatactcgccctgaaaatatgcccaagcaggtgcaatcaaatatttgg
gacgtggttgctcatggtggacataaacgcgcccatactcaggctaatcttaattggcaa
gcggtattaggccagcctgaagtcctctattttgactttccctatgaggccgatccaaaa
gagcacggctattactgggcgagccgtaataccaattcgcaaaaaatccacagctttatg
gcgggtaacttaccagcaaacgccgagcaatggactgatatcgaagcgctgccgtttgaa
gccgacgatatgctaaaaaaagatgaagcgggtaaaatcattagtgggccactaaaagca
tcgattcgttttgcaggtattcaaggccaactatggagcgaaacagtgcgcagtgatgat
gtggctgaatacatgatgtttcctcgtctgatgatgctagcagagcgtgcatggcacaag
ccagagtgggaagtgccatatcaataccaaggtgcggtttataatcagcaaagtggttat
ttcacgaaagagatgcgtcaagcacaagccaaagattggcaccgcgtggcaaacacctta
ggtgctaaagagctattaaagctagataaagcaggtattgcctatcgagtaccgacaccc
ggtgctgtcataaatgacggtaaattgtttgccaatgttattttcccaggacttagcatt
gaataccgtgatgctaaaggacagtggcaggcatattccgatggcgtaacggttaccgcg
cctgttgaggtgcgtgtgattgcggctgatggcaagcgtaaagggcgcattttagttgtt
aattaa

DBGET integrated database retrieval system