KEGG   Shewanella halifaxensis: Shal_1157Help
Entry
Shal_1157         CDS       T00654                                 

Definition
(GenBank) Glutaminase (EC:3.5.1.2)
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
shl  Shewanella halifaxensis
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shal_1157
   00220 Arginine biosynthesis
    Shal_1157
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Shal_1157
Enzymes [BR:shl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Shal_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1407587..1408501
Genome map
AA seq 304 aa AA seqDB search
MPELALLEEIVEKVRPLLGQGKVADYIPALAQVDANKLGIAVTTSDGVTIGAGDYLEPFS
IQSISKVFSLTLALMLYEEDEIWSRVGKEPSGHSFNSLVQVELEKGLPRNPFINAGALVI
ADLLQSRLGAPKHRMLEIVRGLSENHRVGYDKVVAASEYQHSARNAAIAYLMKSFGNFNN
DVNTVLHSYFHYCSLRMSCADLSRAMFYLANSGKSLAGKQLISPVQNRQLNALLATSGLY
DGAGEFAYRVGMPGKSGVGGGIIAVIPGDMSVCVWSPELDANGNSLAGTAVLETLSQTLG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattggcattacttgaagagatcgtcgaaaaagtacgacctcttttaggacag
ggtaaagtggctgactatattccagcccttgcccaagtcgatgctaataagttaggtatt
gcggtgaccacctctgacggtgtcacaataggggctggagattatctcgagcccttttca
attcagagtatctctaaggtgttcagtcttaccttggcactaatgctgtatgaagaagat
gagatttggtcacgagtcggtaaagaaccctctggccactcttttaactctttagtacag
gttgaattagaaaaaggcttaccgcgaaatccttttattaatgctggcgcgttggtcatt
gccgatcttctgcagagtcgcctgggtgcgcctaagcaccggatgcttgaaattgttcgg
ggtttaagtgaaaaccatagagtgggttacgacaaagtcgttgccgcgtctgaatatcaa
cacagtgcgagaaacgccgctattgcttacctgatgaaatcatttggtaactttaataac
gacgtcaatactgtgctacacagctactttcactattgctcacttcgtatgagctgcgcc
gatctatcccgtgctatgttttatctggctaactctggtaaaagcctcgcaggtaagcaa
cttatttcgccggtgcaaaatcggcagctaaatgccttattagccacatctggtctttat
gacggtgcgggtgagttcgcttatcgagtcggtatgccgggtaagagcggtgtcggtggc
ggcattatcgcggtgatccctggcgatatgtctgtgtgtgtttggtctcctgaacttgat
gccaatggtaactctttggcaggcactgcagtgttagagaccttgagccagactctaggc
cggtctattttttag

DBGET integrated database retrieval system