KEGG   Shewanella halifaxensis: Shal_1228Help
Entry
Shal_1228         CDS       T00654                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
shl  Shewanella halifaxensis
Brite
Enzymes [BR:shl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Shal_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1492049..1492684
Genome map
AA seq 211 aa AA seqDB search
MTPVASTSALNLARSLYEAGIRNEAVLQAVANTPREQFLDAALGHKAYENTALPIGQGQT
ISQPYIVAKMTEIILQTKPTKVLEIGTGSGYQAAILARLVPQLFTVERIKSLQIQARQRL
KRLDLHNIAFKYGDGWEGWPSKGPYDAIMVTAAASSIPDALVSQLADGGILVIPVGEIAQ
QLLKVTRSGDKYRSEVVEDVRFVPLINGELA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagttgcctcaacatcagcattgaaccttgcaagaagtctgtatgaggctggg
atccgcaatgaggcagtattacaggctgtggcaaacactccgagggagcaatttcttgat
gcagctctgggtcacaaagcttatgaaaatacggcgctacctattgggcagggacaaact
atttctcagccctacattgttgccaaaatgactgagatcatcttgcaaactaagcccact
aaagtattggagataggaacgggctcagggtatcaagccgctattctcgcacggttagtg
ccacaactctttacggtggagcggatcaagagtttacagatccaagctaggcagagattg
aaaagactcgatctgcataatatcgcttttaaatatggcgatggctgggaagggtggccg
agcaaaggaccttatgatgcgatcatggttactgctgcagcgagttcaatccctgatgct
ctagtatctcaattagcagatggtggcatattagtgatccctgtaggggaaatcgctcag
cagttattaaaagtgacacgcagtggtgataaatacaggtctgaagttgtagaagatgta
cgcttcgtaccgcttatcaatggtgagctggcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system