KEGG   Shewanella halifaxensis: Shal_1352Help
Entry
Shal_1352         CDS       T00654                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
shl  Shewanella halifaxensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shal_1352
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shal_1352
   00630 Glyoxylate and dicarboxylate metabolism
    Shal_1352
Enzymes [BR:shl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Shal_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1626595..1628232
Genome map
AA seq 545 aa AA seqDB search
MTEQLTALESSDTLVSSQELQINGSAVAGQEQVLTEGTLCLLKALCKQFAAEVPNLLANR
QAKQKRIDSGELPDFLEETQALRQRDWLIRGIPQDLQDRRVEITGPVERKMVINALNANA
KVFMADFEDSLAPSWQKIVQGQINLRDAVNGDISYIATETGKHYSLNDNPAVLICRVRGL
HMLEQHVQFGGVAIPASLFDFCVYFYNNYRKLLSKGSGPYFYIPKLESHLEARWWAKVFA
FVEERFCLQPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKTLNNH
SDRVLPDRQSVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPSKDAEINQQVLDKVK
QDKQLEARNGHDGTWVAHPGLADTAMAIFNEYIGEDHINQLHITRDVDAPIHARELLKPA
KGECTEAGMRLNIRIALQYIESWINGNGCVPIYGLMEDAATAEISRTSIWQWIKHLQPLS
SGAIVTKGLFQEMLVEELAHVKDEVGADRFTHGSFTQAAVLLEQITTSDELVDFLTEPGY
QILVE
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcaattaactgcactagagagctcagatacattggtgtcgagtcaagagtta
cagattaatgggtctgcagtggcaggccaagagcaggtgctgacagagggcacattgtgt
ttgcttaaggccttatgcaagcagtttgccgcagaggtgcccaatttgcttgccaataga
caggctaagcaaaagcgtatcgattcaggcgagttgcctgattttctagaagagactcaa
gcgctgcgtcagcgagattggctgatccgcggcattccccaagacttacaagatagacgc
gtcgagatcactggccctgttgaaagaaaaatggtcattaatgcgcttaatgcaaatgcc
aaagtatttatggctgactttgaagattcacttgctccaagctggcaaaaaatcgtgcaa
ggacaaataaacctgcgtgatgcagttaacggcgacattagctatatcgcaacggaaact
ggcaagcattactcgctaaatgataatcccgcagtgctcatctgccgagtgcgtggttta
catatgttggagcagcatgtgcagtttggtggggtcgcaattccagcgagcttgtttgat
ttttgcgtctatttctacaataactaccgcaagttattgagtaaaggcagcgggccttac
ttttatatccctaaacttgaaagtcatcttgaggctagatggtgggctaaggtatttgca
tttgttgaggagcggttttgcctgcagcccggtacgataaagtgtacctgtttaattgaa
actcttccggctgtgtttgagatggatgagatcttatatgaactgcgctctaacattgtt
gcactgaactgcggtcgttgggattatatttttagctatattaaaactctaaataaccat
agcgacagggtgttgcccgatagacagtcggtcaccatggataagccattcttgagtgct
tattctcgtttgttgattaaaacctgtcataagcgtggcgccttagccatgggggggatg
gcggcctttattccatcaaaggatgccgagattaaccagcaagtgctagataaggttaag
caagataagcagttagaagcgcgtaatggtcatgatggtacttgggttgctcacccggga
cttgccgatactgcgatggccatttttaacgaatacataggtgaagatcatattaatcaa
ctacacatcactcgtgacgttgatgctcctattcacgccagagaactactcaagcccgca
aagggggagtgcacagaagcgggcatgcgcctcaacattcgaattgcactgcaatatatc
gagtcttggattaatggcaacggctgtgtgcctatttacggcttgatggaagatgccgcc
actgcagagatatctcgtacatctatttggcagtggataaagcacctgcagccgcttagc
tctggcgcaattgtgactaaaggcttgtttcaagagatgttggtagaggagctcgcccac
gttaaagacgaggtcggtgcagaccgttttacccatggcagttttactcaggctgcggtt
ctgttagagcagatcaccacttcagacgagctggtcgacttcttaacggagccgggatat
caaatactggtggagtaa

DBGET integrated database retrieval system