KEGG   Shewanella halifaxensis: Shal_1469Help
Entry
Shal_1469         CDS       T00654                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
shl  Shewanella halifaxensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:shl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:shl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1767620..1768810
Genome map
AA seq 396 aa AA seqDB search
MGIKVLVVDDSSFFRRRVSEIVNKDSELEVVGTACNGAEAVKMAAELNPNVITMDIEMPV
MDGITAVKQIMASKPIPILMFSSLTHDGAKATLEALDAGALDFLPKRFEDIASNKDDAIA
LLQQRIRALGRRRLFRPIARPLTGNERAQPANTSSATSERAADRARTSSSFSRPSVTASA
ANAAAASTTERSASRASVITRGSGKKYKALLIGTSTGGPVALQKVLTQLPANYPHPILLI
QHMPAAFTPTFATRLNSLCKIEVKEAETGDQLKPGCAYLAPGGMQMMLERGGAYGRIKVI
AGKADMNYKPCVDITFASASKVIGGDVLAVVLTGMGADGREGARMLKGIGATVWAQDEAS
CVVYGMPQAVTAAGIATKSIALEHMAESIIKETCNG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggcattaaagttttagtcgttgatgattcgagttttttcagacgacgcgttagtgaa
atagttaataaagactccgagctagaggttgtgggtaccgcatgtaatggtgctgaggct
gtaaaaatggccgcagagcttaatccaaatgtgatcaccatggacattgaaatgccggtc
atggatgggatcactgcggtaaagcagatcatggcgagcaagccaattcctattctaatg
ttctcatcacttacacatgatggtgccaaagcaacgttagaagcgttagatgctggtgcc
ttagacttcttgccaaagcgttttgaagatatcgctagcaataaagatgatgcgatagcg
ctattgcagcaacgaattagagcattaggccgtagacgcttatttagaccgattgctagg
cctctgactggcaatgaaagagcgcaacctgcaaatactagtagtgctactagtgagagg
gccgccgatagagcgcgcacctcatctagcttttctcggccgtcagttaccgcatctgcg
gcgaacgctgcggctgcgagtacaactgaaaggtctgctagtcgagccagtgttattact
cgtggcagtggaaaaaagtataaagcattacttatcggcacatctacaggaggcccggtt
gcgctacaaaaggtattaacccaactgcctgcgaattatccgcatcctattttgcttatc
cagcatatgccagccgcttttacaccaacctttgcaacaaggcttaatagcttgtgtaag
attgaagttaaagaggcggaaaccggcgatcagttaaagccaggctgcgcatacctagcg
ccaggcggcatgcaaatgatgttagagcgaggcggagcttacggcagaatcaaggtgatt
gcgggtaaggccgatatgaattacaaaccttgtgtcgatatcaccttcgcctcagcttct
aaagtgattggtggagacgtattggctgtggtattgacgggcatgggagccgatggtcga
gaaggagcgagaatgcttaaaggcatcggcgctactgtgtgggcgcaggatgaggcaagc
tgtgtggtttatggtatgccacaagcggtaacggcagctggtattgcgactaaatcgata
gccttagagcatatggctgaatctattataaaagagacctgcaatggctaa

DBGET integrated database retrieval system