KEGG   Shewanella halifaxensis: Shal_1609Help
Entry
Shal_1609         CDS       T00654                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
shl  Shewanella halifaxensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shal_1609
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Shal_1609
Enzymes [BR:shl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Shal_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1933455..1934462
Genome map
AA seq 335 aa AA seqDB search
MSYLMLDIESTELSAAESAQLAHPMIGGLILFSRNYVDRVQLVTLIQSIRAVRPDIVIAV
DHEGGRVQRFRDGFTVLPAMGDILPAAKGDMAQAKEWATELGYLMAIELLAVDIDLSFAP
VLDLNGVSQVIGTRSFSPDKTEVVELAGAFIDGMEQAGMCAVGKHFPGHGSVEADSHIAK
PVDERTKDDIFANDMQPFKALIAKNRLQGIMPAHVIYPKVDSQPAGFSSFWLQDVLRQQL
TFNGVIFSDDLGMKGAAVAGGYTARAQAALDAGCNMILVCNDSEGATEVLNNVQWPSDDK
GLSANLLKPELSRVTRALEDNTRWERAKAIAKNLI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttgatgttagatatcgagtccacggagctcagtgcagctgaatcggcgcaa
ttagctcaccctatgataggtggattgattctatttagtcgtaattatgttgatcgcgtc
caacttgtcacccttattcagtctattcgcgcggttcgtcccgatatcgtgattgccgtc
gatcatgaaggtggcagagtacagcgttttcgtgatggttttacggttctgcctgcgatg
ggagatattttacccgctgcaaaaggcgatatggcacaggccaaggagtgggctacagag
ctaggctatctaatggctattgagttattggctgttgatatcgatttgagttttgccccc
gtactcgacttaaatggtgttagccaagtgataggcacaagaagttttagccctgataag
actgaggtggtagaacttgctggtgcatttattgatggtatggaacaagcgggtatgtgc
gcggttggcaaacattttccaggccacggcagcgtcgaagccgactcgcatattgctaag
ccagttgatgagcgcacaaaagatgatatttttgctaatgacatgcagccatttaaggcg
ttaatcgccaaaaatcgattacaaggcattatgcctgcacatgttatttatcctaaagtc
gatagtcagcctgcgggtttctcttcattttggttgcaagacgtactgcgtcagcaatta
acgtttaacggcgtcattttctctgatgacctagggatgaagggcgctgcagtggctggt
ggatacacggcaagggcgcaggctgctctcgatgcgggctgcaacatgattttagtgtgt
aacgatagcgaaggagcgactgaggtactcaataacgttcagtggccgagtgatgataag
ggccttagtgcaaacttactaaagccagaactgagccgagtgaccagagcccttgaagac
aatacacgttgggagcgtgcaaaagctattgctaaaaatttgatttaa

DBGET integrated database retrieval system