KEGG   Shewanella halifaxensis: Shal_1654Help
Entry
Shal_1654         CDS       T00654                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
shl  Shewanella halifaxensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shal_1654
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shal_1654
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shal_1654
Enzymes [BR:shl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Shal_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1983823..1985082)
Genome map
AA seq 419 aa AA seqDB search
MSKLNPYFGEYGGMYVPQILMPALKQLETAFIEAQEDEAFQEEFTDLLKNYAGRPTALTL
TRNLSPNPLAKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSATLKDACNEAMRDWSGCY
DKAHYLLGTAAGPHPYPTIVREFQRMIGAETKRQILEREGRLPDAVIACVGGGSNAIGMF
ADFIDEPEVALIGVEPAGKGIDTPMHGAPLHHGKTGIFFGMKAPLMQDSEGQVEESYSVS
AGLDFPSVGPQHAHLAAIGRATYESATDDEALETFQLLARCEGIIPALESAHAIAYAVKL
AKEATKETLLVVNLSGRGDKDIFTVADILEQQKVEQQKVEQQKADNQNTEKNNQESGNE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttaaatccctactttggggaatacggtggtatgtacgttccacaaatctta
atgccagcacttaagcagctagagaccgcatttattgaagcgcaagaagacgaagcgttt
caagaagaatttaccgacctattaaagaactatgcgggtcgcccaacggcattaacgcta
acccgtaacttaagccctaacccactggctaagatttacttaaagcgtgaagacctactt
catggtggcgcccacaagaccaaccaagtactaggtcaggcgctactagcaaagcgcatg
ggcaagaaagagatcattgccgagacgggcgcgggtcaacacggcgtggcaacggcactt
gcctgtgccctgctcggtcttaaatgcagagtatatatgggcgccaaagatgttgagcgt
caatcacctaacgtatttagaatgaagttaatgggcgcagaagtgatcccggtaacctca
ggctctgccaccttaaaagatgcttgtaacgaagcgatgcgtgactggtctggttgttat
gacaaggcccactatctacttggcaccgctgcggggcctcatccatatcctacaatagta
cgcgagttccagcgcatgattggcgctgaaactaagcgtcaaattcttgagcgtgaaggt
cgcctgcccgatgccgttattgcctgtgttggcggtggttcaaatgcgattggtatgttt
gccgactttatcgatgagccagaggttgccttgattggggttgagcctgcaggtaaaggc
attgatacgccaatgcatggcgcgccacttcatcatggtaaaacggggattttcttcggt
atgaaagcgccactgatgcaagatagcgaaggtcaagtcgaagagtcttactctgtatcg
gcaggccttgatttcccatcggttgggccgcaacatgcgcaccttgccgccattggccgc
gcaacttacgagtcggcgaccgatgatgaagcactggaaaccttccaactgctcgcccgc
tgtgaagggattattccggcactggaatcggctcacgcaatcgcttatgcggtgaagtta
gccaaagaagccaccaaagagaccctattagtggttaacctatcgggccgtggtgacaaa
gatatcttcaccgttgcggacattcttgagcaacaaaaagttgagcaacaaaaagttgag
caacaaaaagctgacaatcagaatacagagaaaaacaatcaggagagtggcaatgagtaa

DBGET integrated database retrieval system