KEGG   Shewanella halifaxensis: Shal_1697Help
Entry
Shal_1697         CDS       T00654                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
shl  Shewanella halifaxensis
Pathway
shl00010  Glycolysis / Gluconeogenesis
shl00620  Pyruvate metabolism
shl00640  Propanoate metabolism
shl00680  Methane metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
shl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shal_1697
   00620 Pyruvate metabolism
    Shal_1697
   00640 Propanoate metabolism
    Shal_1697
  Energy metabolism
   00680 Methane metabolism
    Shal_1697
Enzymes [BR:shl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Shal_1697
Lipid biosynthesis proteins [BR:shl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Shal_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABZ76263
JGI: Shal1697
UniProt: B0TPY4
Position
complement(2034792..2036744)
Genome map
AA seq 650 aa AA seqDB search
MSTQSLYKVPSEIAANALVNDEQYKKMYQESIVNPEGFWREHGNRIDWIKPFTKVKKTSF
DDHNLFIKWFYDGTLNASANCLDRHLENNADKLAIIWEGDDAKDQRTLTYGQLHTQVCKF
ANALRSQGVRRGDVVTIYMPMVPEAAVAMLACARIGAIHSVVFGGFSPDSIASRVIDGNS
KVVITADEGVRAGRIIPLKANIDEALSHPDVNCVEKVIVMKRTGGDINWVEGRDIWWDSL
MDTASEHCIAEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYVFDYKENEV
YWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNYPSPARLGEMVDRHKVNILYTAPTL
IRALMAEGKEQFAGFDGSSLRIMGSVGEPINPEAWRWYNDVIGHEKCPIVDTWWQTETGG
ILISPLPGATDTKPGSATRPFFGVQPALVDNMGNIVDGASEGNLVILDSWPGQMRTVFGD
HDRFVLTYFKTFRGMYFTGDGAKRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVAHE
FVAEAAVVGYPHDIKGQGIYAYVTLTKGSVETEELRQELRQWVRKEIGALATPDLIQWAG
GLPKTRSGKIMRRFLRKIAANEVSNLGDSSTLADPAVIDTLIETRLNRSE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagtctctctataaagttccaagtgaaatcgctgcaaacgcacttgtaaac
gatgaacaatataaaaaaatgtaccaggagtcgattgtaaaccctgaaggtttctggaga
gaacacggcaaccgtatcgactggataaagccctttactaaggtaaagaaaacctctttc
gatgaccacaacttatttattaagtggttctacgatggcacgcttaacgcgtctgcaaac
tgtttagatagacacctagaaaacaatgccgataagctggccattatttgggaaggtgat
gacgctaaagatcagcgtacgctgacttacggccaattacatacgcaagtctgtaaattt
gctaatgcactgcgtagccaaggtgtacgccgtggtgacgtcgtcactatatacatgcct
atggtacctgaagcggctgttgctatgcttgcatgtgcccgtattggtgccattcactct
gttgtctttggtggtttctcacccgactcgattgcctcacgtgtgattgacggtaattca
aaagtggttatcacggccgatgaaggtgtgcgtgctggtcgtatcattccacttaaagcc
aatatcgatgaagccctttctcatcctgatgtaaactgcgttgaaaaagtcatcgtgatg
aaacgcacgggtggagatatcaactgggttgaaggtcgtgatatctggtgggactcctta
atggatactgcatcagagcattgcattgctgaagagatgggcgcagaagatccgctgttc
ctgctctatacatcaggctcaactggtaaccctaaaggtgtgcttcataccacgggtggt
tacatggtttacgcagccatgacccacgaatatgtattcgattacaaagagaatgaagtt
tattggtgtacggcagatgtaggctggatcaccggtcactcttacatggtttacggacca
ctagccaatggcgcaacagtgcttattcatgaaggcgtaccaaactatccaagcccagcc
cgtttaggtgagatggttgaccgtcataaagtaaacattctttatacggctccaacgctt
attcgcgcactaatggctgaaggaaaagagcagtttgcaggctttgatggtagctcactg
cggattatgggctcggtgggtgagcctattaatcctgaagcttggcgctggtataacgat
gttattggtcatgagaaatgcccaattgttgatacttggtggcaaacggaaactggcggg
attttgattagcccactgccaggtgcaacggataccaaaccaggctctgcaacccgtcca
ttctttggcgtacaaccagcacttgtcgataatatgggtaatatcgttgacggtgctagc
gaaggtaacttagttatcttagattcttggccggggcagatgcgtaccgtatttggcgat
cacgaccgattcgtactgacttactttaaaacatttagaggcatgtactttaccggtgat
ggtgctaagcgtgacgaagacggttactactggatcaccggacgtgtcgatgatgtgatt
aacgtatcgggtcaccgtttaggtaccgctgaagttgaaagtgcattagttgctcacgag
ttcgtagcagaggctgctgttgtaggttatccgcacgatattaagggacaagggatctac
gcctatgtcaccttgaccaaagggtcggttgaaaccgaagagctgcgccaagagttaaga
caatgggtaagaaaagagattggtgcccttgcgaccccagatcttatccagtgggcaggc
ggtttacctaaaacacgctcgggcaaaattatgcgccgtttcctacgcaagattgcggct
aatgaggtcagcaacttaggtgactcttcgacactcgcggatcctgccgttatcgataca
ctgattgagacgcgtcttaatcgtagcgaataa

DBGET integrated database retrieval system