KEGG   Shewanella halifaxensis: Shal_1738Help
Entry
Shal_1738         CDS       T00654                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
shl  Shewanella halifaxensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2084447..2085472)
Genome map
AA seq 341 aa AA seqDB search
MANPLLKESASKLKKAIPLMLKHQIPTTPTNYALWYAYVGEKSPKLNLYLDQVVSQYSTC
PPSHSERLYREFLSDPIELDIVDMRLNLDAMVTELSQSLKDTNLDANQFHSKIKNNYNKL
NKIESDGFTIEEVLSVIKNLVQDANEIRVSAQQFSEQLARAQSEIDTLKLQLKQSEHEMH
FDALTNSLNRRAFNKDLKGIIELHPQGLCLIIADIDHFKVFNDTYGHQLGDQVLKAVTKR
LTEACQDGTKLYRFGGEEFALIVPKSQLGRARQLAESMRRSLEKLILKDRRKGDTINNIS
ASFGVAEYQLNDTDNQLIERADKQLYEAKRLGRNRVMPISV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccattgctaaaggaatctgcatcgaaattaaagaaagcgattcctttaatg
ttgaaacatcagatcccgacgacaccgacaaactatgctctctggtatgcctatgtcggt
gagaaaagcccaaagcttaacctatatttagatcaagtcgtcagtcagtacagcacctgc
ccgccaagtcatagcgaacgcctttatcgagagtttttatcagatcctattgagcttgat
attgtcgatatgcgcctcaatctcgacgcaatggtgacagagctttctcaatcgcttaaa
gacactaaccttgatgctaatcagttccacagcaaaataaaaaacaattacaacaagctc
aataaaatcgagagtgacggttttaccattgaagaagtgctaagcgttatcaaaaacctt
gttcaagacgcaaatgaaatacgcgttagtgcccagcaattttctgagcagctcgctagg
gcgcaatcagaaattgacacgcttaagctacaattaaagcagtctgaacatgagatgcac
tttgatgccttaacaaattctctaaaccgccgagcatttaataaagatctcaaaggaatt
attgagctgcacccacagggtctttgtttaatcattgccgatatcgatcactttaaagtg
tttaacgacacatacggccaccagcttggcgatcaagtattaaaagccgtgactaaacgc
ttaactgaggcttgccaagatggcactaaactgtatcgctttggcggtgaagagtttgcc
ctcattgtgccgaagagccaattaggccgagcccgtcaattggctgaatctatgcgccgt
agtctagagaagttgattttgaaagataggcgaaaaggagacacgattaacaacattagt
gcctcttttggcgttgccgaatatcaattaaacgatactgataaccagttaatagagcgg
gctgacaaacagctttatgaagcaaagcgcttaggaagaaaccgcgtaatgcctatctca
gtctaa

DBGET integrated database retrieval system