KEGG   Shewanella halifaxensis: Shal_1805Help
Entry
Shal_1805         CDS       T00654                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
shl  Shewanella halifaxensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:shl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2158507..2159436
Genome map
AA seq 309 aa AA seqDB search
MTTIADKPDYSLYSNAFGYLRQPLDFKPLEGDADVVVLGLPFDMATTGRSGGRMGPGAIR
NASVNLAWEETRWPYQFKLSDHVKIVDAGDLVYNCGDSADFTQRVEDFATKILEADKAML
SFGGDHFVTLPLLRAHYKKHGKMALLHFDAHTDTYSQGSKYDHGTMFYHAPIEGIIAAEN
SIQVGIRTEYDTANHLFKVIDAATANDLTADEIVAQIRERVGDMPLYVTFDIDCLDPAFA
PGTGTPVCGGLTSDKAMKIIRGLKGMKIVGMDVVEVAPAYDSAEITALAGATLGLEMLHV
WAESNGKVK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccactattgcagataagcctgattattcgctttattcaaatgcatttggttactta
agacagccgttagactttaaacctctagaaggcgatgcggatgtagtcgtgttaggctta
cctttcgatatggctaccacggggcgctctggcggtcgtatggggcctggtgcgattcgt
aacgcttctgtaaacttggcttgggaagaaactcgctggccttatcagtttaaattaagc
gatcacgtgaaaattgtcgatgcgggtgacttagtttataactgtggcgattctgctgat
tttacccagcgtgttgaagatttcgcgacaaagatcctagaagctgacaaagcgatgctc
agctttggtggcgatcactttgtgactctgcctctgctacgtgctcactataagaagcac
ggtaagatggcactattgcattttgatgcgcacactgacacttatagccaaggcagtaaa
tatgatcacggcaccatgttctatcatgcgccaattgaagggattatcgcagccgagaac
tcaatccaagtcggcattcgtactgaatacgatacagctaatcacctttttaaagtgatt
gacgctgcaactgcaaacgacctgacagccgatgaaattgtggctcaaattcgtgaacga
gtgggtgatatgccactttatgtgactttcgatattgactgtttagatcccgctttcgca
cctggcactggtactcccgtatgtggcggtttgacaagcgacaaggcgatgaaaattatc
cgcggtttaaaaggcatgaagattgtgggtatggatgtggttgaagtcgctccagcctat
gatagcgcagagatcacggcattggctggagctacattaggcttagagatgctgcacgtt
tgggctgagtctaatggcaaagttaaataa

DBGET integrated database retrieval system