KEGG   Shewanella halifaxensis: Shal_1855Help
Entry
Shal_1855         CDS       T00654                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
shl  Shewanella halifaxensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:shl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Shal_1855
Enzymes [BR:shl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Shal_1855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2219255..2221228)
Genome map
AA seq 657 aa AA seqDB search
MITTTLPINELLKQWQNERLLTSLDRHFALEMTKQHHDSSPLFTLICALVSQHLSSQHTC
LPLKQIDLTNPFKEQSSQCQINLDLSQLEQALLAFDAIGTPEDEEPKPLIMDKGNLYLQR
YYHYEKEVAGALKRLAHSPQTSEQSDASIEQASELLSKLFPPTEQQYDWQKIATATAMTK
KLAVITGGPGTGKTTTVTKLLYLLCEGQELTIRLVAPTGKAAARLSESIKASKQRLANDL
SQAGVADLDKNIANIPEEAATLHRLLGVIPNSHQFRHHKDNPLRLDLLVIDEASMVDLPM
MHKVLSALPEHARLILLGDQDQLASVEAGAVLADICQGLKQVSKTTKQSRWHMRYSQSQA
ELLSQLTSTELSEFINPNPKIGDSLCMLMHSHRFKGDAGIGQLAAAVNHANIARIAQVWQ
TGYQELQWIEHGLVNTHSSAQTNTGLESLLAQAVQQYGVYLAQISQTQGDAEAIIDCFNQ
YRILCAMRAGEYGVEGINQGVTMALAAQGLINPEQEFYAGRPIIIQSNDYNLGLFNGDIG
LILPDNHSETGRLMAHFIQADGSLLKVLPARLPSHETCYAMTVHKSQGSEFSHVSLVLPI
RPSIAQQQLLSKELIYTAITRAKHHFTCLGSQRVFEHASTCLTQRASGLAQRLWREE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgataacaacgactctgccgattaatgaattgttgaaacagtggcaaaatgagcgtctg
ctcacctctcttgatcgccactttgcgttagagatgaccaagcagcatcatgattcatcg
ccactgtttacgcttatctgtgcccttgttagtcagcatctgtcgagccaacatacttgc
ttgccgctaaaacagatagatttaactaatccgtttaaagaacaaagcagtcaatgccag
attaacctagatctgagtcagctagagcaagcgctattagcattcgatgccatcggcacg
cctgaagatgaagagcctaagccacttattatggataaaggtaacctttatctacagcgg
tattaccactacgaaaaagaggtcgcaggcgcgctcaagcgtttagcccattcgccacaa
accagtgaacagagcgacgccagtattgagcaagcaagcgagttactgtccaaacttttt
cctccgacagagcagcaatatgactggcaaaaaatagccaccgccacggcaatgactaag
aagttagccgtcattactggcggcccgggtacaggtaaaacgactacggtgactaagtta
ctgtatttgttgtgcgaagggcaagagttaaccattcgactggtggcgccaacaggtaaa
gcggcagcgcgtttaagtgagtcgattaaggcctcaaagcagcggcttgctaatgatcta
agccaagcgggcgtcgccgatttagacaaaaatatagccaacattccagaagaagcggcc
accctgcaccgcttgttaggggttattcctaattcacaccagtttaggcaccataaagat
aacccgttaagactcgatctcttagtgatcgatgaagcctctatggtcgacttacctatg
atgcacaaggtgttatctgcgctacctgagcacgccagactcattttacttggcgatcag
gatcagctggcctcagtggaggctggcgctgtgctcgcggatatttgccaaggcttgaag
caagtctctaaaacaaccaagcaaagccgctggcatatgcgttattcgcaatcccaagcg
gagctactcagtcagctaaccagcactgagttatctgagtttatcaaccctaaccccaag
attggcgatagcctctgcatgttaatgcacagtcatcgtttcaaaggtgatgccggtatt
ggccagctagccgccgcggtcaatcacgctaatattgcgcgtattgcacaggtatggcag
acaggctatcaggagttgcagtggatagaacatggcttggttaacacccatagcagtgct
caaactaatactggactggaaagcttattggcccaagccgttcagcagtacggcgtttat
ttagcccagataagccaaacacaaggcgatgctgaggccattatcgactgctttaatcag
tatcgcattctatgtgcgatgcgagcgggtgaatacggcgtagaggggatcaaccaaggc
gtgacgatggctctcgccgcacaaggtctcattaatcccgagcaagagttttacgctggg
agaccgattatcatacagagcaacgattacaaccttgggctgtttaatggtgatataggg
cttattttacccgataatcacagcgaaacgggtcgcttaatggcgcactttatccaggcc
gacggtagcttgcttaaagtcttgcctgctagactgccaagccatgaaacctgttatgca
atgacggtacataaaagccaaggcagtgagtttagtcacgtctctttagtactgccgata
aggccaagtattgcccagcaacagttactgtctaaagagttgatttatactgccattact
cgagctaaacaccactttacttgcctgggaagccaaagagtatttgagcacgcaagtacc
tgcctaacccagcgtgcatcgggattagctcagcgattatggcgcgaggaataa

DBGET integrated database retrieval system