KEGG   Shewanella halifaxensis: Shal_1950Help
Entry
Shal_1950         CDS       T00654                                 

Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
shl  Shewanella halifaxensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shal_1950
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shal_1950
Enzymes [BR:shl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Shal_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2344260..2344964
Genome map
AA seq 234 aa AA seqDB search
MIKETVFKSFDNKEALEAQLAERIANQLQDAVDARGKASLIVSGGSTPLKLFELLSKKGI
DWSDVYITLADERWVSAEHSDSNERLVRNNLLKNRAANAKFRGLKNMYSSPEEGCAMAIE
QLGSFPTPFDVVVLGMGNDGHTCSWFPCAAEAELDNALTTTDLCVAVKPGNAPHSRITLS
KSAILASRQIYLHIVGEQKLDVYRQALASDDCREMPIRAVLGQHKTPVDVYWSA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagaaactgttttcaaatcatttgacaataaagaagcactcgaagcacaactg
gcggagcgtattgccaatcaactgcaagacgccgttgatgcccgtggtaaagcgagcctt
attgtctcaggtggctcaactccgcttaagttatttgaattgctcagtaagaaaggcatc
gattggagtgatgtttacatcacactcgcggatgagcgctgggtcagtgctgagcatagt
gattctaacgagcgcctagttcgaaataatttgctaaagaatagagcggctaatgccaaa
tttcgtggcttgaagaacatgtattcttcgcctgaagaaggttgcgccatggcgattgaa
caacttggtagttttcctacaccattcgatgtcgtcgtattaggcatgggcaatgacggc
catacctgctcttggttcccttgcgccgcagaagctgaactcgacaatgcattaacgaca
accgacttatgtgttgccgttaaaccgggtaatgccccgcattcaaggattactttgtcg
aagtcagccattttagcgagtcgtcaaatctatttacatatcgttggtgagcaaaaatta
gatgtttaccgacaagcactagcaagcgatgactgtcgtgaaatgcctatccgagcggtg
ctcggccagcataaaacgcctgttgatgtttactggagcgcttaa

DBGET integrated database retrieval system