KEGG   Shewanella halifaxensis: Shal_1950Help
Entry
Shal_1950         CDS       T00654                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
shl  Shewanella halifaxensis
Pathway
shl00030  Pentose phosphate pathway
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
shl01200  Carbon metabolism
Module
shl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
shl_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
shl_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shal_1950
Enzymes [BR:shl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Shal_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: ABZ76515
JGI: Shal1950
UniProt: B0TSD5
Position
2344260..2344964
Genome map
AA seq 234 aa AA seqDB search
MIKETVFKSFDNKEALEAQLAERIANQLQDAVDARGKASLIVSGGSTPLKLFELLSKKGI
DWSDVYITLADERWVSAEHSDSNERLVRNNLLKNRAANAKFRGLKNMYSSPEEGCAMAIE
QLGSFPTPFDVVVLGMGNDGHTCSWFPCAAEAELDNALTTTDLCVAVKPGNAPHSRITLS
KSAILASRQIYLHIVGEQKLDVYRQALASDDCREMPIRAVLGQHKTPVDVYWSA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagaaactgttttcaaatcatttgacaataaagaagcactcgaagcacaactg
gcggagcgtattgccaatcaactgcaagacgccgttgatgcccgtggtaaagcgagcctt
attgtctcaggtggctcaactccgcttaagttatttgaattgctcagtaagaaaggcatc
gattggagtgatgtttacatcacactcgcggatgagcgctgggtcagtgctgagcatagt
gattctaacgagcgcctagttcgaaataatttgctaaagaatagagcggctaatgccaaa
tttcgtggcttgaagaacatgtattcttcgcctgaagaaggttgcgccatggcgattgaa
caacttggtagttttcctacaccattcgatgtcgtcgtattaggcatgggcaatgacggc
catacctgctcttggttcccttgcgccgcagaagctgaactcgacaatgcattaacgaca
accgacttatgtgttgccgttaaaccgggtaatgccccgcattcaaggattactttgtcg
aagtcagccattttagcgagtcgtcaaatctatttacatatcgttggtgagcaaaaatta
gatgtttaccgacaagcactagcaagcgatgactgtcgtgaaatgcctatccgagcggtg
ctcggccagcataaaacgcctgttgatgtttactggagcgcttaa

DBGET integrated database retrieval system