KEGG   Shewanella halifaxensis: Shal_1957Help
Entry
Shal_1957         CDS       T00654                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
shl  Shewanella halifaxensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2352073..2353125
Genome map
AA seq 350 aa AA seqDB search
MDMAKHLSETELSAKILRHAVPKMSELKVPVTPENYAVWYEYYKGINLDLKRAIDGLLSN
NVAFTPDVSSSLYKNYILINSPEIIENVQLETQVLINSLLAKIGSLSKDTSRFSDSLTEF
DNALKQDPDPVVMQKLVKGITSELDEIIAVNGEMDKSLTSMNEEVIALKSEMVELRSVAM
TDQLTSVNNRRAFDKEVISHIDSFNHSNFDSSLLVVDIDHFKRFNDIHGHLVGDKVLAYV
AQALKNGVKGDDFVARYGGEEFVILLPNTTQEEANIVAENLRQKIAERNLTIGKDKKLPL
GNITVSVGVASLKAADDKDSYFIRADEALYRAKSSGRNCVVSERITETAI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggatatggcaaagcatttatcagaaacagaactgtcggctaagatattacgccatgca
gtgcctaaaatgtctgaactcaaggttccagtcactcctgagaattatgccgtttggtat
gaatactataaagggattaatcttgatttaaagcgtgcgatcgatggattactgagcaat
aacgtcgcctttacaccagatgtcagcagtagtctttataaaaactatatcttgattaac
tcacccgaaattattgagaatgtccaattagaaacacaagtactgataaatagtttactg
gccaaaattggctctttgagcaaggacacatcacgattttcagattcattaactgaattt
gataacgcattgaaacaggatcccgaccccgttgtcatgcagaaactggttaaagggatc
accagtgagcttgatgaaatcattgccgttaatggtgaaatggataaaagcctaacgagc
atgaatgaagaggttattgcccttaaatcagaaatggtagagcttcgctccgttgctatg
accgatcagttaacctcagtgaataatcgccgtgcattcgataaagaagtgattagccat
atcgatagttttaatcattcaaattttgacagtagtttgttagtcgtcgatattgaccac
tttaagcggtttaatgacatacatggccatttagtcggtgacaaagtactggcttacgtt
gcccaggcattaaaaaatggcgttaaaggcgatgatttcgttgcccgttatggcggtgaa
gagtttgttatcctgttgcctaataccacacaggaagaagcgaatatcgtagccgagaat
ttaaggcaaaagatcgcggagcgtaatttgaccataggtaaagacaaaaagctgccgctt
gggaatattaccgtgtcagtaggagttgcatcgctaaaagcagcagatgataaagatagc
tattttattcgtgccgatgaagccttataccgtgctaagtcttcgggccgaaactgtgtc
gtaagtgaaagaattacagagacagctatttag

DBGET integrated database retrieval system