KEGG   Shewanella halifaxensis: Shal_2004Help
Entry
Shal_2004         CDS       T00654                                 

Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
shl  Shewanella halifaxensis
Pathway
shl00564  Glycerophospholipid metabolism
shl00565  Ether lipid metabolism
shl00590  Arachidonic acid metabolism
shl00592  alpha-Linolenic acid metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Shal_2004
   00565 Ether lipid metabolism
    Shal_2004
   00590 Arachidonic acid metabolism
    Shal_2004
   00591 Linoleic acid metabolism
    Shal_2004
   00592 alpha-Linolenic acid metabolism
    Shal_2004
Enzymes [BR:shl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Shal_2004
    3.1.1.32  phospholipase A1
     Shal_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ABZ76565
JGI: Shal2004
UniProt: B0TT04
Position
2418058..2418903
Genome map
AA seq 281 aa AA seqDB search
MKHKTNIILLASLVVAGPLQAKEQSTISKDITGVAGLTPLEDLYKLTTFDNNFILPVYQT
QAANQSYYAPQNPNKEEISNTNLQFQFSLKYGIANNLFTDNDGFYIAYSQISNWQAYDKS
AYFRDSQYQPQVFWFWQHSDESDTWQSTSVGFEHQSNGKGGVYERSWNRVYLEFSLAFSD
LEVSIKPWLRTDFSSTDYNPDIEDYMGYGSVKGDWYFGEHQVSLTLRNLVESGFSKGYEE
LSWRFPIYKGLRGYLKLQSGYGLTISDYNHFDNAVGIGIAL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcacaaaactaatatcatattgctagcgagcttagtggtcgcagggccactacag
gcaaaagagcagagcactattagcaaggatatcacgggcgtcgctgggttaacgccacta
gaagacctctataaactgacgacatttgacaataatttcatcctgcctgtttatcaaact
caagcagcaaatcaatcttactacgctcctcaaaacccaaacaaagaagagatcagtaac
accaatctccagtttcagttcagtctgaaatatggcattgctaataacctcttcaccgat
aatgacggcttttatatcgcttacagccaaatatctaattggcaagcttatgacaagtca
gcctatttccgtgactcacaatatcagccacaagtattttggttttggcagcactcagac
gaaagtgatacttggcaaagcactagcgtaggtttcgagcaccaatcgaatggtaagggt
ggtgtttatgagcggagttggaaccgagtttatttggagttttctttagcatttagcgat
cttgaggtaagcataaaaccttggctaagaacagatttttcaagtactgattataatcca
gatattgaagactatatgggttatggttcggtaaaaggcgactggtactttggcgagcac
caagtgagtttaacactacgtaaccttgtagaaagtggcttttctaagggctatgaggag
ttgagctggcgctttccaatatataaagggttaagaggctacttgaaactgcaaagtgga
tatggactaaccatctctgattataatcattttgataatgctgtaggcattggtattgca
ctttaa

DBGET integrated database retrieval system