KEGG   Shewanella halifaxensis: Shal_2127Help
Entry
Shal_2127         CDS       T00654                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
shl  Shewanella halifaxensis
Pathway
shl00071  Fatty acid degradation
shl00280  Valine, leucine and isoleucine degradation
shl00281  Geraniol degradation
shl00310  Lysine degradation
shl00360  Phenylalanine metabolism
shl00362  Benzoate degradation
shl00380  Tryptophan metabolism
shl00410  beta-Alanine metabolism
shl00627  Aminobenzoate degradation
shl00640  Propanoate metabolism
shl00650  Butanoate metabolism
shl00903  Limonene and pinene degradation
shl00930  Caprolactam degradation
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
shl01212  Fatty acid metabolism
Module
shl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Shal_2127
   00650 Butanoate metabolism
    Shal_2127
  Lipid metabolism
   00071 Fatty acid degradation
    Shal_2127
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shal_2127
   00310 Lysine degradation
    Shal_2127
   00360 Phenylalanine metabolism
    Shal_2127
   00380 Tryptophan metabolism
    Shal_2127
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shal_2127
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Shal_2127
   00281 Geraniol degradation
    Shal_2127
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shal_2127
   00627 Aminobenzoate degradation
    Shal_2127
   00930 Caprolactam degradation
    Shal_2127
Enzymes [BR:shl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Shal_2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABZ76686
JGI: Shal2127
UniProt: B0TTW8
Position
2561948..2562904
Genome map
AA seq 318 aa AA seqDB search
MPNNTAHSEAAAQTTANQLASLDGCHREDLDGVVFYEVREQVAIVTMNRPEYNNAQNSKM
TYALDAAFKRACDDDNVKVIILAGEGKHFSAGHDIGTPGRDVDQEFDRASLWYDHSNKSG
GEFLYAREQEVYLGMCRRWRDMPKPTIAMVQGACIAGGLMLAWVCDLIICSDDAYYCDPV
VRMGIPGVEYFAHVHELNPRIAKEFLFLGDKMNAQRAYELGMVNRIFARKDLTEETLTIA
NKIAQMPRLGLQLTKQAINNAEDLMGKRSTMDMVFGLHHFAHVHNESISGDKLGGFDAKA
MAKANKAASVSDKRKEAS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacaatacagctcacagtgaagcggccgcccaaactacggctaaccagctagcg
tcgcttgatggatgtcaccgcgaagatcttgatggcgttgtgttttatgaagtgcgggaa
caagtcgcaatcgtaaccatgaatcgccctgaatataacaatgcacaaaattctaaaatg
acctacgcgctcgacgcggcttttaaacgagcgtgcgatgatgacaacgtaaaagtgatc
atactcgcaggtgaaggtaagcacttttcagccggacatgacatcggcactcctggacgc
gacgttgaccaagagtttgatcgtgccagtctttggtacgaccacagcaataaaagtggt
ggtgagtttttatatgctagagagcaagaggtttacttaggcatgtgtcgccgctggcgt
gatatgccaaaacccactattgcaatggtacagggtgcctgtattgccggagggctaatg
ttagcctgggtgtgcgatcttattatctgctctgacgatgcctattactgtgacccggtt
gttcgaatggggatcccgggcgttgaatactttgcgcacgtgcatgagcttaaccctcga
atcgcaaaagagtttttattcttaggcgacaaaatgaatgctcagcgtgcctatgagtta
ggcatggtgaaccgaatatttgcacgaaaagatttaactgaagaaacgttaaccatagct
aataaaatcgcccaaatgccccgacttggtctgcaattaactaagcaagccattaataac
gccgaagatctgatgggcaaacgtagcacgatggatatggtttttggcttacaccatttt
gctcatgttcataatgagtcaatatccggtgacaagctcggtggtttcgatgcaaaagcg
atggcaaaagccaataaggccgcaagtgtgtcagataagcgaaaggaggcatcatga

DBGET integrated database retrieval system