KEGG   Shewanella halifaxensis: Shal_2310Help
Entry
Shal_2310         CDS       T00654                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
shl  Shewanella halifaxensis
Pathway
shl00300  Lysine biosynthesis
shl01100  Metabolic pathways
shl01120  Microbial metabolism in diverse environments
shl01230  Biosynthesis of amino acids
Module
shl_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Shal_2310
Enzymes [BR:shl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Shal_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABZ76869
JGI: Shal2310
UniProt: B0TVI4
Position
2794655..2795800
Genome map
AA seq 381 aa AA seqDB search
MSQNTDSPVLSLAKDLISRQSVTPLDEGCQQLMADRLADAGFNIESMVFEDTTNMWARRG
TQSPVFCFAGHTDVVPVGDLNRWHTPPFEPVVIDDYLHGRGAADMKGSLAAMLVATERFI
KKFPDHQGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVKN
GRRGSLTGNLTVKGVQGHVAYPHLADNPIHKAAPALDELARMKWDNGNEFFPPTSFQIAN
INGGTGASNVIPGALEVMFNFRYSTEVTAEILIERVLNILDAHGLEYDIDWVFNGLPFLT
GDGPLLEATKAAIKKVTGTNTDPQTSGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVK
VSDLELLTDCYEAILENLLCK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaatacagactctccagtactttcattagccaaagaccttatttctcgtcaa
tcggtcacacctttagatgaaggttgccagcaactcatggctgacagattagccgacgca
ggctttaatattgagtcaatggtatttgaagataccaccaatatgtgggctcgcagaggc
acgcaatctcccgtcttttgttttgcaggccataccgatgttgtcccagttggagatcta
aatcgttggcacacaccaccgtttgagccagttgttattgatgattatcttcatgggcgc
ggcgctgcagatatgaaaggctcattggcggcgatgctggtggctaccgagcgcttcatt
aaaaagtttccggatcatcaaggctcaatcgcctttctgatcaccagtgatgaggaaggc
ccttttattaatggcacaactcgagtcatcgatacccttgaagcacgtaacgaaaaaatc
acctggtcgctcgtgggagaaccttcatccacccataagctaggtgatatcgttaagaat
gggcgccgaggcagtctcacaggtaatttaacggttaaaggagttcaagggcacgtggct
tacccacaccttgctgataaccctattcataaagccgctcctgcgctagatgagcttgcg
agaatgaaatgggataatggtaatgagtttttcccgccgactagctttcaaatcgcaaat
atcaacggcggtacaggcgcatcaaacgttataccaggtgctttagaggtgatgtttaat
tttcgctactccaccgaagttaccgccgaaatattaatagagcgagtgctcaatattctc
gatgctcacggcttagagtacgatatcgattgggtcttcaatggcttgccttttctaact
ggcgatggacctttattagaagcaactaaagctgcaatcaaaaaagttactggaacgaat
accgatccacaaacatcgggtggcacgtcagatggtcgttttattgctccaaccggggca
caggttattgagcttggccctgttaatgctaccattcataaagtgaacgagtgtgtcaaa
gtatcagaccttgagttactcaccgattgttatgaagccattttggaaaacctgctgtgc
aagtag

DBGET integrated database retrieval system