KEGG   Shewanella halifaxensis: Shal_2406Help
Entry
Shal_2406         CDS       T00654                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
shl  Shewanella halifaxensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2905919..2906911
Genome map
AA seq 330 aa AA seqDB search
MNKLSLISVALLSTLSINANAANEPIEIIPAAVITNPEKVELGKMLFFEPRLSKSGFISC
NSCHNLSTGGVDALPTSIGHNWQEGPINSPTVLNAEYGLAQFWDGRAKDLKEQAAGPIAN
PKEMDFTHELAVDTVRSMPAYQARFAKVYDSKDVNIDMITDAIAEFEKTLVTPNAPFDLY
LQGDKDAINEQAKAGYQLFKDKGCVSCHNGPAVGGTMYMKMGLVKPFHTDNPAEGRKGVT
GNEADKFVFKVPTLRNIELTYPYFHDGSVWELEEAVNTMADIQLGQKLSAQEVKEMVAFL
DSLTGDQPQIVLPILPPSNKDTPRPLPFAD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcttagtttaatctccgtcgctctactttcaacactatcgattaacgcaaat
gccgcgaacgaacctatcgaaatcattccagcagccgtgatcactaaccctgaaaaagtt
gagcttggaaagatgctattcttcgaaccaagactgtccaaatctggcttcatttcatgt
aactcttgccataacttgtctacaggtggcgttgatgcactaccaacatcaattggtcat
aactggcaagaaggccctattaactcaccaactgtacttaacgccgaatatggtcttgcg
cagttctgggacggtcgagcaaaagatctaaaagagcaagcagcgggtcctattgccaat
ccaaaagagatggacttcacccatgaattggcagtcgacaccgttcgttctatgcctgct
tatcaggctcgttttgcaaaagtctatgactctaaagacgttaacatcgatatgatcacc
gatgcgattgctgagtttgagaaaacacttgtcacaccaaacgcaccatttgatctgtat
ctgcagggcgacaaagacgccatcaacgagcaagcaaaagcgggttatcagttatttaag
gataaaggctgcgtgagctgtcacaatggtccagcggttggtggcactatgtacatgaag
atgggcctagttaagccatttcataccgacaatccagctgaaggcagaaaaggcgtaacg
ggtaacgaagccgacaagtttgtgtttaaagtgccgacgctacgtaatatagaactaacc
tacccatacttccacgatggtagtgtttgggagctagaggaagccgttaatactatggct
gatattcaacttggacagaagttgtcagctcaagaggttaaagagatggttgcattccta
gactccttgacaggtgatcaaccacaaatcgtactgccaatattaccgccatctaacaag
gacacccctagaccgcttccatttgcagattag

DBGET integrated database retrieval system