KEGG   Shewanella halifaxensis: Shal_2427Help
Entry
Shal_2427         CDS       T00654                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
shl  Shewanella halifaxensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Shal_2427
  Lipid metabolism
   00561 Glycerolipid metabolism
    Shal_2427
   00600 Sphingolipid metabolism
    Shal_2427
Enzymes [BR:shl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Shal_2427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2929117..2930478
Genome map
AA seq 453 aa AA seqDB search
MTKITIIGAGSVMFTRQLVSALLSYPALQKMHLELMDLNPQVLARSEKLITLMVAQAKVP
VTVSATTDRKQALIGADFVLNLIQVGGLEPWRLDIEIPAKYGVIQEVGDTMGPGGIFRAL
RHIPPMVEILKDMEQVCPNALFINYANPLAPLTWAAKEFSTIKSVGLCYGVRYTVAQLAG
YLGLGEWIEHPSTPEIWQQLMYKEVPGEIDYEFAGINHMTWITKLTVDGEDKLADIQRIV
DDPKVYAADGVRCEVLKFFGHWCTENHWHCSDYLPYFRKNEAMINEFLPNRWNLLALEEK
VHAAGKLEVDAQLAGEKDFVIAPNMLNAPKLINAIVSGERTRINGNVANQQQDGLLIDNL
PQNCVVEVPIWADSKGLHPQPMGRLPTQCASLIKTNTAVQELIVEAALNRDLDAARYALS
LDPVTATVCTLEQIDAMFKEMVEAQKQWLPEFN
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattacgattattggtgctggcagtgtaatgttcactcgccaactcgtttcg
gcgctgctctcctatcctgcactgcagaagatgcatctggagctcatggatctcaatcct
caggtgcttgcccgcagcgaaaagttgatcactctgatggttgcacaggccaaggtgccc
gtaactgtgagtgcgactactgacaggaagcaagcgctcatcggtgctgatttcgtgctc
aaccttattcaagttggtggcctcgagccatggcgtcttgatatcgagatccctgcaaaa
tatggggttatccaagaggtgggggatacgatggggccaggtggtattttcagggctctg
aggcacatcccgccaatggttgagatccttaaagatatggagcaggtctgccccaatgcc
ttgtttatcaactatgccaatccgttagcgccactgacatgggcggcgaaggaatttagc
actataaaaagtgtgggtctctgttatggcgtacgttacaccgttgcacaattagctggc
tatttagggcttggcgagtggattgagcatccatctacgcctgagatctggcagcagcta
atgtataaagaggtgcccggcgagatagactatgagtttgctggcatcaaccatatgacc
tggataactaagctgacggtcgatggggaagataagcttgccgatattcagcgcattgtc
gatgatcctaaggtctatgctgccgatggtgtgcgctgcgaggtgcttaaattcttcggc
cactggtgtacagagaaccactggcactgcagcgattacctgccctattttagaaaaaat
gaagcgatgataaatgagtttctacccaaccgctggaacctgttagcacttgaagaaaaa
gttcatgcggcaggcaagctagaggtagatgctcaactggctggagagaaggattttgtg
atcgcccccaatatgctcaatgcccctaagcttatcaacgccatcgtcagcggtgagcga
acccggatcaacggtaatgtcgccaatcagcagcaagatggtctgttaatcgataatctg
ccacaaaactgtgtggttgaagtgcctatctgggcggatagcaaagggctacacccacag
cctatgggcagattacccacccagtgcgccagcttaattaaaaccaatactgcagtgcag
gagctgatagttgaagcggcgcttaatcgcgatctcgatgccgcccgatatgcattgtca
ctcgatcctgtcactgcaacagtttgtactcttgagcagatagatgccatgttcaaagag
atggttgaagcgcaaaaacagtggctacccgagtttaattag

DBGET integrated database retrieval system